(data stored in ACNUC7421 zone)

EMBL: CP001622.PE152

CP001622.PE152       Location/Qualifiers
FT   CDS_pept        150032..150757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0153"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG:
FT                   rec:RHECIAT_CH0000559 copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54464"
FT                   /db_xref="GOA:C6AZD8"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD8"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACS54464.1"
FT                   /translation="MTILLEVCVDSAEGLAAAIEGGAGRIELCSALELGGLTPLPSLMR
FT                   IAARAPIPVYAMIRPHAGPFIFDGADEEAMMIDIDAVRAAGLAGVVIGANRPDGTLDMP
FT                   LVHRLKAHAAGLGSTLHRAFDLVPDADQALEQAVELGCERILTSGCALKAVDGLDTLKR
FT                   ISAKAAGRIAIMPGSGIRPTNVGEILKATGAREVHGSCSSPVESADPRAVAFGFEARST
FT                   NKTDVAVVRQMRRAIEAGV"
     atgacgatct tgcttgaggt gtgcgtggac agcgccgaag gccttgccgc cgcgatcgag        60
     ggtggcgccg ggcgcatcga gctctgctcg gcgttggaac tcggcggcct gacgccgttg       120
     ccgagcctga tgcggatcgc cgcccgggca cccattccgg tctatgcgat gatccgccct       180
     cacgccggcc ccttcatctt cgacggggca gacgaggagg cgatgatgat cgatatcgac       240
     gccgtgcgcg ccgccggcct tgccggcgtc gtcatcggcg ccaaccggcc ggatggtacg       300
     ctcgacatgc cgctggtcca ccgtttgaag gcgcatgcgg cgggactcgg ctcgacgctg       360
     catcgcgctt ttgatctggt gccggatgcc gaccaggcgc tggagcaggc ggtcgagctc       420
     ggctgcgaac gcatcctgac atcaggctgc gcgctgaagg cggtagacgg cctcgacacg       480
     ctgaagcgca tttcggcaaa ggccgccggc cgcatcgcca tcatgcccgg cagcggcatc       540
     cgccccacca atgtcggcga gatattgaag gcgaccggcg cccgcgaggt ccacggctcc       600
     tgcagttcac cggtcgaaag cgccgatccg cgcgcggtcg cttttggttt cgaggcgaga       660
     agcacaaaca agacggatgt cgccgtcgtc aggcagatgc gcagggcgat cgaggcggga       720
     gtttag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page