(data stored in ACNUC7421 zone)

EMBL: CP001622.PE153

CP001622.PE153       Location/Qualifiers
FT   CDS_pept        complement(150992..152011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0154"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   rec:RHECIAT_CH0000560 probable Zn-dependent alcohol
FT                   dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54465"
FT                   /db_xref="GOA:C6AZD9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZD9"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS54465.1"
FT                   /translation="MKAVLCREPGVLDIVERPSPAAPAAGWVRLAVSHVGICGTDYHIF
FT                   EGKHPFLEYPRVMGHEISATVLEAGDGVTIAVGTPVIVNPYLSCGQCIACRQGKPNCCT
FT                   NIKVLGVHTDGAFCEEISVPAENLYAAKGVSLEAAATTEFLAIGAHAVRRSMTGAGARA
FT                   LVIGAGPIGLGAAIFSRIAGHEVTLLDTSTERLQMASERFGFTSGIVANEATAETVREK
FT                   TNGDGFDVVFDATGYGPSMEKAFSFVAHGGALVLVSVVKDDIRFSDPEFHKREMMVIGS
FT                   RNATRVDFEHVADSIAKGLVPVDKLITHRTTLADAPRDLARWAHEKNGLIKAVISIGG"
     atgaaagcag ttctttgccg ggagcccggc gtgctcgata tcgtcgagcg tccttcgcct        60
     gcggctcccg ccgccggctg ggtgcggctt gccgtcagcc atgtcggcat ttgcggcacc       120
     gactaccaca tcttcgaggg caaacatccc ttcctcgaat atcccagggt gatggggcac       180
     gagatctcgg cgacggtgct ggaagcgggc gacggcgtca ctatcgcagt cggcacgcct       240
     gtcatcgtca atccctatct ctcctgcggg caatgtatcg cctgccggca gggcaagccg       300
     aattgctgca ccaatatcaa ggtgctcggc gtccataccg acggcgcctt ctgcgaggag       360
     atttcagtcc cggccgagaa cctctacgcc gccaagggtg taagcctcga agcggcggcg       420
     acgaccgagt tcctggcgat cggcgctcat gcggtgcgcc gttcgatgac cggtgccgga       480
     gcccgggcgc tcgtgatcgg cgccgggccg atcggcctcg gggcggcgat cttctcgcgc       540
     atcgcaggcc atgaggtgac gctgctcgat accagcaccg agcggctgca gatggcgtcg       600
     gaacgcttcg gcttcacctc cggcatcgtt gccaacgagg cgacagcgga gaccgtccgg       660
     gaaaagacca acggcgacgg tttcgacgtg gtcttcgatg cgacgggtta cggcccttcg       720
     atggaaaagg ccttctcctt cgtcgcccat ggcggcgcgc tggtgctggt cagcgtcgtc       780
     aaggacgata tccgcttctc cgatcccgaa ttccacaagc gcgagatgat ggtgatcggc       840
     agccgcaacg ccacccgcgt cgatttcgag catgtcgcgg attcgatcgc caaagggctg       900
     gtgccggtgg acaaactgat cacccaccgc acgacgcttg ccgatgcgcc gcgcgatctc       960
     gcgcgctggg cgcatgagaa gaatgggctg atcaaggctg tgatcagtat tggtggttag      1020
//

If you have problems or comments...

PBIL Back to PBIL home page