(data stored in ACNUC7421 zone)

EMBL: CP001622.PE154

CP001622.PE154       Location/Qualifiers
FT   CDS_pept        complement(152244..153218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0155"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000561 probable sugar ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54466"
FT                   /db_xref="GOA:C6AZE0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS54466.1"
FT                   /translation="MTATPTEIVAPPPRRKMNILFGLTLIGLLIFLWIVLGVVTPSFWT
FT                   PLNISNLLRQGAMTAILALGQTFVIITAGIDLSVGAIVGFCTVIIAWLLQAGVPVWGAI
FT                   ALTLLMGVAIGAFHGFGIVHMGLPPFIITLATLTSLRGIGLLITNGSTINITNEGFSNF
FT                   ARADLLSIPSLFWMVILVAVPSFIFLHLSRWGRYLFAVGSNAEAARLSGVNVKGMIYLA
FT                   YILSASFAAFVGVLLASRIAIGNATQADGWELQAIASSVIGGTSLFGAVGSVHGPLIGA
FT                   FILATINNGANLLNVNSFWQRIITGLLIIVIVFFDQLRRRRSN"
     atgactgcca cccccaccga aatcgtcgca ccgccgccgc gccggaaaat gaacatcctg        60
     ttcggcctga cgctgatcgg cctgctgatc ttcctctgga tcgtgcttgg cgtcgtcacc       120
     ccgagcttct ggacgccgct caacatctcc aacctgctgc gtcagggtgc gatgacggcg       180
     atcctggcgc tcggccagac cttcgtcatc atcaccgccg gcatcgatct ttcggtcggc       240
     gccatcgtcg gcttctgcac cgtgatcatc gcctggctgc tgcaggcggg cgtgccggtc       300
     tggggggcga tcgcgctgac gctgctcatg ggtgtggcga tcggcgcctt ccatggcttc       360
     ggcatcgtgc atatgggcct gccgcccttt atcatcacgc tggcaaccct gacatcgctg       420
     cgcggcatcg gcctgctgat caccaacggc tcgacgatca acatcaccaa tgagggcttc       480
     agcaatttcg cccgcgccga tctgctcagt attccgagcc tgttctggat ggtcatcctg       540
     gtggcggtcc catccttcat cttcctgcat ctgagccgct ggggccggta tctcttcgcg       600
     gtcggttcga acgccgaggc ggcgcgcctt tccggcgtca acgtcaaggg catgatctac       660
     ctcgcctata tcctgtctgc ctccttcgcc gccttcgtcg gcgtgctgct cgcctcgcgc       720
     atcgcgatcg gcaatgcgac gcaggccgac ggctgggaac tgcaggcgat cgcctcctcc       780
     gtcatcggcg gcaccagcct gttcggcgcg gtcggctcgg tgcacggccc actgatcggc       840
     gccttcattc tcgccaccat caacaacggc gcgaaccttc tgaacgtcaa ctccttctgg       900
     cagcgtatca tcaccggtct gctgatcatc gtgatcgtgt tcttcgacca gctgcgccgc       960
     cgccggagca attga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page