(data stored in ACNUC7421 zone)

EMBL: CP001622.PE155

CP001622.PE155       Location/Qualifiers
FT   CDS_pept        complement(153246..154799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0156"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH00491 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54467"
FT                   /db_xref="GOA:C6AZE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54467.1"
FT                   /translation="MIGLEEVSHRHDDSATLKEANRIPAGSPILELKGLQKNYGHVQAL
FT                   KPATLTFLAGEIHAIVGENGAGKSTLIKLLTGVITRTAGEVLWCGQPVGLATPNEAIAR
FT                   GINAVHQEVVLCRHLTVAANLFLGDEVNRFGLMRKKQMEKMAQAVLDDLGFGLPAGALL
FT                   SSLTIGQQQLVATARAAMRGTQFLIFDEPTAYLTRQESAQLFKLIRRLQGEGVTIVYIS
FT                   HRMEEVFELADRVSVLRDGTHVGTRLIGETNDAELISLMINRSIEQIYHKEKIAIGETI
FT                   LTVNGLSGPGFEDVSLSVKAGQIVGLYGLIGAGRSEFALGLYGRQPTTAGDVEWMGKRV
FT                   DIRNERTAMELGIALAPESRRDQGLCLNLPIGLNINLPVFGRLSHGPVINHTRESANAD
FT                   QQIRNLSIKTPSRRVPASSMSGGNQQKIVIGKWLSHGARLFIFDEPTVGVDVGTKAEIY
FT                   RLFAKLLKDGAGIILISSYLPEVYELADRLHVFRAGKIVASHDYHAATHEEVLSEAIGV
FT                   "
     atgatcggac tggaagaggt cagtcatcgc catgatgaca gtgcgacgct gaaagaagcc        60
     aatcgaattc ccgccggatc gcctatcctc gaactcaagg gcctgcagaa gaattacggt       120
     catgtgcagg cgctgaagcc agcgacgctg acctttctcg ccggcgaaat ccacgccatc       180
     gtcggtgaaa acggcgccgg caaatccacc ctcatcaaat tgctgaccgg cgtcatcacc       240
     cgcaccgccg gcgaagtgct gtggtgcggc cagccggtgg ggctggcgac gccgaacgag       300
     gcgatcgccc gcggcatcaa cgccgtgcac caggaagtcg tgctctgccg gcacctgacg       360
     gtcgccgcca atctcttcct cggcgatgaa gtcaaccgct tcggcctgat gcgcaagaag       420
     cagatggaga agatggcgca ggccgtgctc gacgatctcg gcttcggcct gccggccggt       480
     gcgctgttga gctcgctgac catcggccag cagcagctgg tggccacggc gcgcgcagcg       540
     atgcgcggca cgcaattcct gatcttcgac gaaccgactg cctatctcac ccgccaggaa       600
     tcggcgcagc tcttcaagct gatccgccgg ctgcagggcg aaggcgtcac catcgtctat       660
     atcagccacc gcatggagga agtcttcgag cttgccgacc gtgtctcggt gctgcgcgac       720
     ggcacgcatg tcggcacgcg cctgatcggc gagaccaacg atgccgaact gatctcgctg       780
     atgatcaacc gctcgatcga acagatctac cacaaggaaa agattgcgat cggcgagacg       840
     atcctcacgg tcaacggcct ctccggcccg ggcttcgaag atgtgtcgct cagcgtcaag       900
     gcgggacaga tcgtcggcct ctacggcctg atcggcgccg ggcgcagcga attcgccctc       960
     gggctctacg gccgccagcc gacgacagca ggcgatgtcg aatggatggg caaacgtgtc      1020
     gacatccgca acgaacgcac ggcgatggag ctcggcattg cgctggcgcc ggaaagccgg      1080
     cgcgatcagg ggctttgcct caacctgccg atcggcctca acatcaacct gccggtgttc      1140
     gggcggctga gccacgggcc ggtgatcaat cacacgcgcg aatcggccaa tgccgaccag      1200
     cagatccgca atctcagcat caagacgccg agccggcgcg ttccggcctc cagcatgtcg      1260
     ggcggcaacc agcagaagat cgtcatcggc aagtggctga gccatggcgc ccggcttttc      1320
     atcttcgacg agccgaccgt cggcgtcgac gtcggcacca aggcggaaat ctaccggctg      1380
     ttcgccaagc ttctgaagga cggcgcgggc atcatcctga tctcctccta tctgcccgag      1440
     gtctacgaac tggccgaccg gctgcacgtc ttccgcgccg gcaaaatcgt cgcgagccat      1500
     gattatcacg cggcgacgca tgaagaagtg ctcagcgaag cgatcggcgt ctga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page