(data stored in ACNUC7421 zone)

EMBL: CP001622.PE156

CP001622.PE156       Location/Qualifiers
FT   CDS_pept        complement(154908..155897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0157"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /note="KEGG: ret:RHE_CH00492 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54468"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE2"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00492"
FT                   /protein_id="ACS54468.1"
FT                   /translation="MSFVKSLLSRRAFTALAGAAVIASAMPAPSFAADVTIPIIVKDTT
FT                   SFYWQIVLAGARKAGKDLGVNVPELGAQAESDVNGQISILENAVAGKPAAVVISPTEFK
FT                   ALGKPIDEAAKSVPIIGIDSGADSKAFKSFLTTDNVQGGRIAADGLAAAIKGATGKEEG
FT                   EIVILTNLPGVGSLEQRREGFLDQVKTKYPGLKVIADKYGDGQATTGLNMMTDLITANP
FT                   NLVGIFASNLIMAQGVGQAIAENKLGEKIKVIGFDSDDKTVGFLKDGAIAGLVVQDPYR
FT                   MGYDGVKTALAVSKGEKVEENVDTGANLVTKANMADPKIDALLNPKIK"
     atgagtttcg tgaaatccct tctgtcccgc cgcgccttta ccgcgcttgc gggcgccgca        60
     gttatcgcct cggcgatgcc ggcaccgtcg tttgcggccg acgtgacgat cccgatcatc       120
     gtcaaggaca cgacgtcctt ctactggcag atcgttctgg ccggcgcccg caaggccggc       180
     aaggatctcg gcgtcaacgt gccggaactc ggcgctcagg ccgaatccga cgtcaacggc       240
     cagatcagca ttcttgagaa cgccgttgcc ggcaagccgg cggccgtcgt catttcgccg       300
     accgaattca aggcgctcgg caagccgatc gatgaagcgg ccaagtcggt tccgatcatc       360
     ggcatcgact cgggcgccga ctccaaggcg ttcaagtcgt tcctgacgac cgacaacgtt       420
     cagggcggcc gcatcgccgc tgacggtctg gccgccgcca tcaagggcgc caccggcaag       480
     gaagagggcg aaatcgtcat cctcaccaac cttccgggcg tcggctcgct ggaacagcgc       540
     cgcgaaggct tcctggatca ggtgaagacc aagtatcccg gcctgaaggt cattgccgac       600
     aagtacggcg acggccaggc aacgaccggc ctcaacatga tgaccgacct gatcacggca       660
     aatccgaacc tcgtcggcat cttcgcctcg aacctgatca tggcgcaggg cgttggccag       720
     gcgatcgccg aaaacaagct cggcgagaag atcaaggtca tcggctttga cagcgacgac       780
     aagacggtcg gcttcctcaa ggatggtgcg attgccggcc tcgtcgttca ggacccctac       840
     cgcatgggtt atgacggcgt gaagaccgcg cttgccgtct ccaagggcga gaaggtcgaa       900
     gagaatgtcg acaccggtgc aaacctcgtc accaaggcga atatggccga cccgaagatc       960
     gacgcgctgc tgaacccgaa gatcaagtaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page