(data stored in ACNUC7421 zone)

EMBL: CP001622.PE157

CP001622.PE157       Location/Qualifiers
FT   CDS_pept        complement(156106..156552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0158"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: ret:RHE_CH00493
FT                   fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54469"
FT                   /db_xref="GOA:C6AZE3"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE3"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ACS54469.1"
FT                   /translation="MLKGIHPLLGPDLLHALKTMGHGDDIVISDANFPSGSMGPPVIRA
FT                   DGVSATDMAAAILTHMPLDTFVPEAAWRMEVVGDPDAMPEVCTEFQQIVSKHAGDFRIV
FT                   PVERFAFYAMARKATYIVATTEFRLYGNLILKKGVVHPHEVDQA"
     atgctcaagg gtattcatcc gctgcttggc cccgacctgc tccatgcatt gaagaccatg        60
     ggacatggcg acgatatcgt catatcggac gccaattttc cctcgggctc gatgggcccg       120
     ccggtcattc gcgccgacgg cgtcagcgcc actgacatgg ccgcggccat cctgacccat       180
     atgccgctcg acactttcgt gccggaagcg gcgtggcgga tggaggtggt cggcgatccc       240
     gatgcgatgc cggaggtctg caccgaattc cagcagatcg tttccaagca cgccggcgat       300
     ttccgcatcg tgccggtgga gcgttttgcg ttttacgcga tggcccgcaa ggcgacctac       360
     atcgtcgcga cgacggaatt tcggctgtac ggcaacctga ttttgaaaaa gggcgtcgtc       420
     catccgcacg aggtcgatca agcctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page