(data stored in ACNUC7421 zone)

EMBL: CP001622.PE158

CP001622.PE158       Location/Qualifiers
FT   CDS_pept        complement(156562..157581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0159"
FT                   /product="Pyridoxal 4-dehydrogenase"
FT                   /EC_number="1.1.1.107"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000565 putative L-fucose dehydrogenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54470"
FT                   /db_xref="GOA:C6AZE4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE4"
FT                   /inference="protein motif:PRIAM:1.1.1.107"
FT                   /protein_id="ACS54470.1"
FT                   /translation="MKTRQIGKTKLEVTEISFGAAALGGLYRACPREVAMDTLQAAWDS
FT                   GIRYFDVAPWYGLGLAERRVGDFLRDQPDGSYVLSTKVGRLLRPVPTGTVPDYSYVDPL
FT                   SFDADYDYSYDGIMRSVEFSYARLGLNRIDILYVHDLGVYTHGAAKNAVHQKQFLDSGV
FT                   KALEELKSSGAISAFGLGVNEVPVCLDVMRHSDLDCILMAGRYTLLDRSAVAELLPLCR
FT                   QKGTSLVVGGVFNSGILATGPVPGSHFDYMPADDDVLAKVGAMEAIAKRHGVPLAAPAL
FT                   QFPLREPIVASVLIGTAKPSSLTRNMEIVEPRLADAIYAEFEPYTLVAPPLGAEAVRV"
     atgaagacga gacagatcgg caagaccaag ctggaggtga ccgaaatcag cttcggtgcg        60
     gccgctctcg gcggtctcta ccgcgcatgc ccgcgcgagg tggcgatgga cacgctgcag       120
     gcggcctggg atagcggcat ccgctatttc gatgtggcgc cctggtatgg gctcggcctt       180
     gccgaacggc gggtcggcga tttcttgcgc gaccagccgg atggcagtta cgtgctttct       240
     accaaggtcg gccggctgct tcggccggtg ccgaccggca ccgtgcctga ttacagctat       300
     gtcgatccgc tctccttcga tgccgattac gactattcct atgacggcat catgcgctcg       360
     gtcgaattca gctatgcgcg cctcggactc aaccgcatcg atattctcta tgtgcacgat       420
     ctcggcgtct acacgcatgg cgcggcgaag aatgcggtcc accagaagca gtttctcgat       480
     tccggcgtga aggcgctgga ggaactcaag tcgtctggcg cgatctccgc cttcggcctc       540
     ggcgtcaacg aagtgccggt ctgcctcgac gttatgcgcc attccgatct cgactgcatc       600
     ctgatggctg gccgctacac gctgctcgac cgctcggccg tcgccgaact gctgccgctt       660
     tgccggcaga agggcacgtc gctcgtcgtc ggcggcgtct tcaactccgg catcctcgcc       720
     accggtccgg taccgggttc gcatttcgac tatatgccgg ctgatgacga tgtgcttgcc       780
     aaagtcggcg cgatggaggc gatcgccaaa cgccacggcg tgccgctggc agcgcccgcc       840
     ctgcagtttc cgctgcgcga accgatcgtc gcatcggtgc tgatcggcac ggcgaagccg       900
     tcgagcctga cgcgcaacat ggagatcgtc gagccgcggc ttgccgacgc gatctacgcc       960
     gaattcgaac cctatacgct ggtcgcgccg ccgctcggcg ccgaagctgt gcgagtctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page