(data stored in ACNUC7421 zone)

EMBL: CP001622.PE159

CP001622.PE159       Location/Qualifiers
FT   CDS_pept        complement(157727..159229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0160"
FT                   /product="Galactarate dehydratase"
FT                   /EC_number="4.2.1.42"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG:
FT                   rec:RHECIAT_CH0000566 probable altronate dehydratase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54471"
FT                   /db_xref="GOA:C6AZE5"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE5"
FT                   /inference="protein motif:PRIAM:4.2.1.42"
FT                   /protein_id="ACS54471.1"
FT                   /translation="MDKLPWIILSAGDNVAVATAAIAPGSTVAGIQTREKIDPGHKVAI
FT                   ADIPLGGPVVKYGQAIGRTTAEVKAGDHVHSHNLHFENDRLAATANSAPEAATADDVGR
FT                   TFMGYRRADGRAATRNYIGIIASVNCSTTVCRAIADEANRTILPHYEGIDGFVPIVHDQ
FT                   GCGMSSTGDGMNVLHRTLAGYTRHVNFGGVLMIGLGCEVNQLTLYGQSGAGASKRHFNI
FT                   QDAGGSRRAVERAMGMLREIAADVGKEKRVPMSIGEIIIGLQCGGSDGFSGITANPALG
FT                   VAADLLAAAGGTAILSETSEIYGAEHLLRSRAVSDEVAKKLDDKIAWWEDYVALHGASL
FT                   DNNPSPGNKRGGLTTILEKSLGAVAKGGRSPLTAVYGYAERVTAPGLVFMDTPGYDPVS
FT                   ATGQVAGGANMIAFTTGRGSCFGCRPAPSLKLSSNSALYASMEEDMDIDCGTIATGDAT
FT                   ISGKGREIFDLIVDTASGKKTKSELFGYGDNEFVPWHLGATL"
     ttggacaaac tgccttggat catcctttcg gccggcgaca atgtcgcggt cgcaacggcg        60
     gcaatcgcgc cgggttcgac ggttgccggc attcagaccc gtgagaagat cgaccccggc       120
     cacaaggtgg cgatagcgga tattccgctc gggggacccg tggtcaaata cggacaggcg       180
     atcggccgca cgacggccga ggtcaaggcc ggcgaccatg tgcacagcca caacctgcat       240
     ttcgaaaacg accggctggc ggcaaccgcc aattcggcgc cggaagcggc gacagccgac       300
     gacgtcgggc gcaccttcat gggctatcgc cgcgccgacg ggcgggcggc aacgcgcaac       360
     tatatcggca tcatcgccag cgtgaactgt tccaccacgg tctgccgggc aatcgccgac       420
     gaggcgaacc ggacgatcct gccgcattat gaaggcatcg acggttttgt gccgatcgtg       480
     cacgaccagg gctgcggcat gagctcgacc ggcgacggca tgaacgtgct gcaccggacg       540
     ctcgccggct atacaaggca cgtgaatttc ggcggcgtgt tgatgatcgg cctcggctgc       600
     gaggtcaacc agctgacgct ctacggccag agtggtgccg gcgcctcgaa gcggcatttc       660
     aacatccagg atgccggcgg gtcgcgccgc gcggtcgagc gcgccatggg catgctgcgc       720
     gaaatcgccg ccgatgtcgg caaagaaaag cgcgtgccga tgtcgatcgg cgagatcatc       780
     atcggcctcc aatgcggcgg ctcggatggc ttttccggca tcaccgccaa tccggcgctc       840
     ggtgtcgcgg ccgatctgct ggcagcggcc ggcggcacgg cgatcctgtc ggaaacctcg       900
     gaaatctatg gtgccgaaca tctgctgcgc agccgcgccg tcagcgacga ggtggcaaag       960
     aagctcgacg acaagatcgc ctggtgggaa gattacgtcg ccctgcacgg cgcctcgctc      1020
     gacaacaacc cctcgcccgg caacaagcgc ggtggcctca caaccatcct cgaaaagtcg      1080
     ctcggcgcgg ttgccaaagg cgggcgttcg ccgctgacgg cggtctatgg ttatgccgag      1140
     cgggtcacgg cccccggcct cgtcttcatg gacacgcccg gctacgaccc ggtctcggcg      1200
     accggccagg tggccggcgg ggcgaacatg atcgccttta ccactggccg cgggagctgc      1260
     ttcggttgcc ggccggcgcc gtcgctgaag ctttccagca attcggcgct ctatgcctcg      1320
     atggaagagg atatggacat cgattgcggc acgatcgcca cgggtgacgc gacgatcagc      1380
     ggcaagggcc gcgagatctt cgacctcatc gtcgatacgg catcaggcaa gaagaccaag      1440
     agcgagctct tcggctacgg cgacaatgaa ttcgtgccgt ggcatctggg tgcgacgctg      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page