(data stored in ACNUC7421 zone)

EMBL: CP001622.PE16

CP001622.PE16        Location/Qualifiers
FT   CDS_pept        complement(13371..13787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0016"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: ret:RHE_CH00371
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54328"
FT                   /db_xref="GOA:C6AYA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS54328.1"
FT                   /translation="MIENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISNILNVPVSFFFEDAPGEHSNAGGGMETSSSNYVVDFLSSSE
FT                   GLQLNRAFVKISDPKVRRKVVELVKALAAEADAD"
     atgattgaaa acaagaagaa gccgaatccg atcgacatcc atgttggcag ccgtattcgt        60
     ctccgccgta cgatgctggg catgagccag gaaaagcttg gcgaaagcct tggcatcacc       120
     ttccagcaga tccagaaata cgaaaagggc accaaccgcg tcggcgcaag ccgtctgcag       180
     aacatctcga acatcctcaa tgttccggtg tcgtttttct tcgaggacgc gcccggcgaa       240
     cattccaatg ccggcggcgg catggaaacc tccagctcga actacgtcgt cgatttcctg       300
     tcttcctcgg agggcctgca gctcaaccgc gccttcgtca agatttccga tcccaaggtt       360
     cgccgcaagg tcgtggagct ggtgaaagcc ttggccgctg aagccgacgc cgactga          417
//

If you have problems or comments...

PBIL Back to PBIL home page