(data stored in ACNUC7421 zone)

EMBL: CP001622.PE160

CP001622.PE160       Location/Qualifiers
FT   CDS_pept        159454..160353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0161"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; KEGG: rec:RHECIAT_CH0000567 probable transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54472"
FT                   /db_xref="GOA:C6AZE6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE6"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS54472.1"
FT                   /translation="MARQNTVFKEAYNRYAVALRTDTALPSEPEIAAQLGVSRSTARAI
FT                   LTRLSEEGIIRWNKRQKIVLRQPTDHDLFPSEETDSLHDIIERSFMQRILADDAAPGMQ
FT                   INELELAREIGTGTTSVREFLIRFSRFGLIEKRPNSHWTLKGFTREFALELADVREMFE
FT                   LHSAAEFGRLPRDNQSWADLAAMRDEHHAMLADINQRFKDFSVLDERFHLLIHRASKNR
FT                   FIADFYDAIAIVFHYHYQWNKAAARQRNERAIHEHLDYIAALESGDQPAIETACRAHLH
FT                   SARQTLLQSLPQVATENA"
     gtggcaaggc agaatacggt cttcaaggaa gcctataaca ggtatgccgt agccctgcgc        60
     acggatacgg cgctgccgtc ggaaccggag atcgccgccc aactcggcgt cagccgctcg       120
     acggcgcgcg ccatcctcac acggctcagc gaagaaggca tcatccgctg gaacaaacgc       180
     cagaagatcg tgctgcgcca gccgactgac catgatctct ttccctccga agaaaccgac       240
     tccctgcatg atatcatcga gcgcagcttc atgcagcgca tccttgccga tgatgcagca       300
     cccggtatgc agatcaacga gttggagctt gcccgcgaga tcggcaccgg caccaccagc       360
     gtgcgcgaat tcctgatccg cttctcccgc ttcggcctca ttgagaaacg gccgaacagc       420
     cactggacgc tcaaagggtt cacccgcgaa ttcgccctcg agcttgccga tgtgcgcgaa       480
     atgttcgagc tgcattccgc cgccgaattc ggccggcttc ccagggataa tcaaagctgg       540
     gccgatcttg ccgctatgcg cgacgaacat cacgccatgc ttgccgacat caaccagcgc       600
     ttcaaggatt tctccgtcct cgacgaacgc ttccacttgc tgatccaccg cgcctcgaag       660
     aaccgcttca tcgccgattt ctacgacgcg atcgccatcg tcttccacta tcactaccag       720
     tggaacaagg ccgccgcccg ccagcgcaac gagcgcgcca tccacgaaca tctggattat       780
     atcgcagcgc tggaatccgg cgaccaacca gcaatcgaaa ccgcctgccg cgcccatctg       840
     cactccgccc gccagaccct gctgcaatcc ctgccgcaag tcgccacaga gaacgcctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page