(data stored in ACNUC7421 zone)

EMBL: CP001622.PE161

CP001622.PE161       Location/Qualifiers
FT   CDS_pept        160617..161735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0162"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54473"
FT                   /db_xref="GOA:C6AUF2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C6AUF2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACS54473.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAET
FT                   LLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAK
FT                   VPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRL
FT                   TYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQ
FT                   EQEGEVQVRVHEGMTGTPPPPPLVLRLIVRRKDPQQAQAEQERLLKDARKRGKKPDPRS
FT                   LEAAKYILLLTSLPTATFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARA
FT                   WLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG"
     atgaagattc gtcctgaggt tttggatcat tggccggaag tgcgcgagcg gcttccggcg        60
     ggttttgact tggaagcaac ggcgcggttg cgcggtgctt ttacgcgggt gcgggaaatc       120
     aagaatgccg agacgctgtt gcggctggca cttgcctatg gcggccttgg catgtcgcta       180
     cgcgagacct gtgcatgggc cgaagcgggc gggatcgccc gtttgtcaga cccatcgctg       240
     ctcgagcggc tgtgcaaagc ggcgccttgg cttggcgaca tcgtggccgc gctgattgcc       300
     gaacaggcca aagtgccgac ggggcgcttt gcgggatatc gcttgcgtgt gctcgatgga       360
     acgtcgatct gccatccggg cgctgaccgc acgacatggc ggttgcatgt cggctacgat       420
     ctggcaacgg ctcaggtcga tcagcttgag ttgaccgaca tccatggtgc cgagaacctt       480
     cagcgcctta cctacgcacc cggcgatatc gtgctggccg atcgctacta tgcaagaccg       540
     cgcgacctgc ggccggtgat cgatgccggt gcagacttca tcgtgcggac cggctggaac       600
     tcgttgcgcc tgttgcagac gaatggcgag ccctttgatc tgtttgccgc actcgccgct       660
     cagcaagagc aggaaggcga ggtgcaggtt cgtgtccacg aaggcatgac ggggacgccg       720
     ccaccaccgc cgctggtcct gcgcctcatt gtccggcgca aggatccgca acaggcccaa       780
     gccgagcaag agcgcctgct caaggatgcc cgcaagcgcg gcaaaaaacc cgatccgcgc       840
     agtctcgagg cggcgaagta cattctgctg ctgacctcgc tgccgaccgc caccttcccg       900
     ccggccgata tcctcaccct ctatcgcttc cgctggcaaa tcgagctggc gttcaaacgg       960
     ttcaagagcc tggccggcct cgacagcttg ccggccaaga agccggaact ggcccgggca      1020
     tggctctacg ccagactgat cgtcgccatc attgccgaac agattgccgg gcaagtcccg      1080
     gactctcccc cctctggatg tggcaacccc actggctag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page