(data stored in ACNUC7421 zone)

EMBL: CP001622.PE162

CP001622.PE162       Location/Qualifiers
FT   CDS_pept        162020..164020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0163"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   domain protein; SbmABacA family protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000570 probable ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54474"
FT                   /db_xref="GOA:C6AZE8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54474.1"
FT                   /translation="MADAKLKPKSVDGTEPHGAGNSPQETASTVEVMPPPDAIEPDPEL
FT                   TPEEAEQARKRYLLKRFWISARRYWGRGGDKFAWPFSIGLLALIGMNVGFQYGINLWNR
FT                   GIFDAIERHDAGTVYFLTAVFVPLVLGTVAIVTIQVAVRMMIQRRWRSWLTTSVIARWL
FT                   ANGRYYQLNLIGGDHKNPEARISEDLRIATEAPVDFIAGVISAFLAASTFIVVLWTIGG
FT                   ALTLPIAGFPVTIPGFLVVTAVLYAAITSTSMAVIGRYFVHVSEAKNQAEAEFRYTLTH
FT                   VRENGESIALLGGEEEERNDLDKTFANVLRQWALLARQHMRTTLVSHGSMLIAPVVPVL
FT                   LCAPKFLEGSMSLGQVMQAASAFAIVQGAFGWLVDNYPRLADWNACARRIASLMMSLDG
FT                   LERAEQSDSLGRIKHGETEGEAMLSLNDLSVSLDDGTAVVTETRVEIEPGERVLVSGES
FT                   GSGKSTLVRAIAGLWPWGGGSVNFHADRRLFMLPQRPYIPSGTLRRAVAYPGAADSWPL
FT                   DEIKAALDKVGLDYLNDKIEEDAPWDQTLSGGEKQRLAFARLLLHQPDIIVLDEATAAL
FT                   DEKSQDKMMQMVIDELPEVTILSVAHRAELEVFHSRKITLERREGGAKLVSDIDLIKRK
FT                   RKRNLLSRVLEKRRSPPKGSTTANEGGTVPE"
     atggccgacg ctaaacttaa accgaaatcg gtcgacggca ccgaaccgca cggtgccggg        60
     aactcgcccc aggagacggc atcgactgtc gaggtcatgc cgccaccaga tgccatcgag       120
     cccgatccgg agttgacacc tgaagaggcc gagcaggcgc gcaagcggta tctgctcaaa       180
     cgtttctgga tcagcgcgcg ccgttactgg ggtcgcggtg gcgacaagtt cgcttggccc       240
     ttctcgatcg ggctattggc cctgatcggc atgaatgtcg gcttccagta cggaatcaat       300
     ctgtggaacc gcgggatctt cgacgccata gagcgacacg atgccggcac cgtctatttc       360
     ctgaccgccg tattcgtgcc gcttgtgctc ggaaccgtcg ccattgtcac gatacaggtc       420
     gccgttcgca tgatgatcca acgtcgctgg cgttcctggc tgacaacatc agtcatcgcg       480
     cgctggcttg caaacggccg ttactatcag ttgaatctca tcggcggcga ccacaagaac       540
     ccggaagcgc gcatttccga ggatttgcgg attgccaccg aagcacccgt cgatttcatc       600
     gccggtgtca tttccgcatt tctggcggcc tcgaccttca tcgtggtgct ctggacgatc       660
     ggcggggctc tcactctgcc gatcgcaggt ttccccgtta ccattcccgg ctttctcgtc       720
     gtcactgcgg tcctctacgc cgcgatcacc tctacttcga tggcggtcat cggccgctat       780
     ttcgtccacg tctccgaggc caaaaatcaa gcagaagccg agtttcgcta cacgctgacg       840
     catgtcaggg aaaacggcga gagcatcgcg cttctcggcg gcgaagagga ggagcgtaac       900
     gacctcgata agaccttcgc caatgtgcta aggcaatggg cgctgcttgc ccgccagcac       960
     atgcgcacaa cgcttgtgtc gcatgggtcg atgctgattg cgccagtcgt cccggtcctg      1020
     ctttgcgcac caaaatttct cgaaggcagc atgagcctcg gacaggtcat gcaggccgcc      1080
     tctgcttttg ccatcgttca gggcgcgttc ggctggctgg tcgacaacta tccccgtctt      1140
     gccgattgga atgcctgtgc acggcgcatc gcctcgctga tgatgtcgct cgacgggctg      1200
     gagcgcgccg aacagagcga ctcgctcggg cgcatcaagc atggtgaaac cgaaggcgag      1260
     gcgatgctca gcctcaacga tctctccgtg tcgcttgacg atggcaccgc cgtggtgacg      1320
     gaaacccggg tcgaaatcga gcccggcgag cgggtgcttg tgtccggtga atccgggtcg      1380
     ggcaagagca cgctggtgcg ggccatcgcg ggtctttggc cgtggggcgg cggcagcgtc      1440
     aatttccatg ccgaccggcg attattcatg ttgccgcaac ggccctatat cccttcgggc      1500
     acgcttcgcc gtgcggtcgc ctatccgggc gccgccgata gctggccgct ggacgagatc      1560
     aaggcggctc tcgacaaggt gggactggat tatctgaacg acaagatcga ggaagatgcg      1620
     ccctgggacc agaccttgtc gggtggcgaa aagcagcggc tcgcctttgc gcgtctgctg      1680
     ctgcaccaac ccgatatcat cgtgctggat gaagcaacgg cagcactcga tgagaagagc      1740
     caggataaga tgatgcagat ggtgatcgat gaattgcctg aagtcaccat cctgagcgtc      1800
     gcgcatcgcg ctgagctgga agtcttccat agccgcaaga tcacgctcga gcggcgcgag      1860
     ggcggcgcaa agcttgtcag cgatatcgac ctgatcaagc gcaagagaaa acggaacttg      1920
     ctgtcacgcg ttttggagaa gcggcgctcc ccgccgaaag gcagtacgac cgcgaatgaa      1980
     ggcggcacag tccccgaata g                                                2001
//

If you have problems or comments...

PBIL Back to PBIL home page