(data stored in ACNUC7421 zone)

EMBL: CP001622.PE163

CP001622.PE163       Location/Qualifiers
FT   CDS_pept        complement(164047..164505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0164"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: cak:Caul_1741 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54475"
FT                   /db_xref="GOA:C6AZE9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZE9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS54475.1"
FT                   /translation="MDDDVLSTPGHLVSLAARGFARLSESRLKPLGFGVGQLPVLVALQ
FT                   DGKASTQRDLARFARIEQPPMAQMLARMERDGLIKRTRDPADRRSSRIVLTKTAQERMP
FT                   KAIAALFQGNREALAGFTDAEAGQLADLLTRLIDNLDQIASAEPSSGV"
     atggacgacg acgtgctttc aacgccgggg catctcgtca gtcttgcggc gcggggcttt        60
     gcccgtctca gcgagtcacg ccttaaaccg ctcggcttcg gtgtcggcca gttgccggtg       120
     ctggtcgcgc tgcaagatgg caaagccagc actcaacgcg acctcgcccg ctttgccagg       180
     atcgagcaac cgccgatggc gcagatgctc gcacgcatgg agagggatgg cttgatcaag       240
     cggacacgcg acccggctga ccgccgcagc agccgtatcg tgctgacgaa aactgcacag       300
     gaacgtatgc cgaaggcaat tgcggcccta ttccaaggga atcgtgaggc actggccggg       360
     ttcacggatg cggaagcggg acaacttgca gatctgctga cgcggctgat cgacaatctg       420
     gatcaaattg cgagcgcaga gccttcgtca ggtgtttga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page