(data stored in ACNUC7421 zone)

EMBL: CP001622.PE164

CP001622.PE164       Location/Qualifiers
FT   CDS_pept        164633..165010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cak:Caul_1742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54476"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF0"
FT                   /inference="similar to AA sequence:KEGG:Caul_1742"
FT                   /protein_id="ACS54476.1"
FT                   /translation="MSQNDVEMIKRIYASFNARDIDAVLAVLSDDVAWANGMDGGHVHG
FT                   REAVRDYWTRQWAVISPHVEPVAFEETPDGAIAVEVIQSVFDLDGRPLEGRAHGLKDKT
FT                   VTHIFRMQGDKIVRFDIRDAL"
     atgtctcaaa atgacgtcga aatgatcaag cgcatctatg ccagcttcaa cgccagagac        60
     atcgacgctg tgcttgccgt gctttccgat gatgtcgcct gggccaacgg catggatggt       120
     ggccatgttc atggtcgtga ggctgtacgc gattattgga cacgccaatg ggccgtcatc       180
     agtccacacg tcgagccggt ggcctttgag gaaacgccag acggcgctat cgctgtcgag       240
     gtgatccagt cggtcttcga cctcgatggc cggccgctgg aagggcgggc tcatggcctg       300
     aaggacaaga ccgtgacgca catcttccgc atgcagggcg ataaaattgt tcgcttcgat       360
     atccgggatg cgctgtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page