(data stored in ACNUC7421 zone)

EMBL: CP001622.PE165

CP001622.PE165       Location/Qualifiers
FT   CDS_pept        complement(165149..165400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54477"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54477.1"
FT                   /translation="MQSSCMHQPWRKKIIKIMVLLHSADGMAWQSPPKGTSLKTLSEAE
FT                   EQGFILIRGEFQKRQFRLTELGSNYVERDKRRLEARRL"
     atgcagtcca gctgtatgca tcagccatgg agaaagaaaa ttataaagat catggtcttg        60
     ctgcacagcg ccgatggcat ggcttggcag tctcccccca aaggcaccag cctgaagaca       120
     ctgagcgaag ccgaggagca aggcttcatc ttgatccgcg gggaatttca gaaacgccaa       180
     ttccgtctga cagagctcgg ctccaactat gtcgagcgcg acaagcggcg tctggaagcg       240
     cgcaggctct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page