(data stored in ACNUC7421 zone)

EMBL: CP001622.PE166

CP001622.PE166       Location/Qualifiers
FT   CDS_pept        165675..166520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0167"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   reh:H16_A2216 SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54478"
FT                   /db_xref="GOA:C6AZF2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS54478.1"
FT                   /translation="MSANLDDIRNHQRETWDKFSAGWKKWDSLVLSWLAPFGDAMLRRA
FT                   NLSNGFNVLDIAAGTGEPGLTAAAAIPEGHVVVTDLSENMLTAAAENAARRGLKNFETR
FT                   LCDAGTLPFADASFDAVLCRFGFMFFPDIAAAAKEMARVAEPGARVSAAVWSAPAKNPW
FT                   ATTIMGTIARHVDISAPPPGSPGLFRCAGEGMMVETFKEAGLLDVAEEEVSAMMVHDTP
FT                   ARYWDFMTEVAAPVVAGLSRADAATREKIRGEVLELALQSVSDGKVYLRSTATVITGTR
FT                   "
     atgtcagcaa atctcgacga tatccgtaac catcaacgtg agacctggga caagttttct        60
     gccggctgga agaaatggga cagcctggtt ctcagctggc tcgccccgtt tggtgacgcc       120
     atgctccggc gcgcaaatct ctccaacggc tttaacgtgc tcgacatagc agctggcact       180
     ggcgaacccg gcctgacggc ggcggcggca atccccgagg gtcatgtcgt cgtcaccgat       240
     ctctcggaaa atatgctgac tgctgccgcc gaaaatgcgg ccagacgtgg cctcaaaaac       300
     ttcgaaactc gcctatgcga tgcgggaacg ttgccttttg ccgatgccag tttcgacgcc       360
     gtcctgtgcc ggtttgggtt tatgttcttc cctgacatcg ctgccgccgc caaggagatg       420
     gcacgcgtgg cagaacccgg tgcgcgtgtc agcgcagccg tctggagcgc gcctgccaaa       480
     aatccatggg cgaccacgat catgggcacg atcgcccgcc acgtggacat atcagcgcca       540
     ccacccggct ctccgggcct gttccgctgt gccggggaag gcatgatggt cgagaccttc       600
     aaagaggcgg gccttctcga tgtcgccgag gaggaggtgt cggcgatgat ggtgcacgat       660
     accccggcgc gctactggga cttcatgact gaggtcgccg cgcctgtcgt cgctggacta       720
     tccagggcag atgcggcgac acgggagaaa atccgcggcg aggttctgga actggcgcta       780
     caatccgtca gcgatggcaa ggtttacctt cgctcaacgg caactgtgat cacaggcacg       840
     cgatag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page