(data stored in ACNUC7421 zone)

EMBL: CP001622.PE167

CP001622.PE167       Location/Qualifiers
FT   CDS_pept        complement(166709..167284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PC0000028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54479"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_PC0000028"
FT                   /protein_id="ACS54479.1"
FT                   /translation="MSVFVLLLGFPGVGKLTIAKELGSLISAKVVDNHWFNNPILRLLD
FT                   EEGTAPLPKGIWEYTGRVRQAVLDAITAYSGPSANFIFTHAGVEGDERSTRTYEQFVEA
FT                   ARQRAAVFVPVRLLCAEEELARRVSAPARRDHLKTTDVETSRSRSQQAVVLNIPHQHAL
FT                   TLDVTLTSPLESAAALRDHVVTCLPNGR"
     atgagtgttt tcgtgttgct cttggggttt ccgggcgtcg gcaagctgac aatcgccaaa        60
     gaactcggct cgcttatatc agcaaaggtc gtcgataatc actggttcaa caacccgatc       120
     ttgcgcctcc tcgacgagga ggggaccgct ccgctgccga agggcatatg ggagtacacc       180
     ggcagggtcc ggcaggccgt cctggatgcg atcaccgcct atagcggccc gtcggcgaat       240
     ttcattttca cccatgccgg tgtcgaaggc gatgagcgga gcacacggac ctacgagcag       300
     ttcgtcgaag ccgccagaca gcgcgccgcg gtcttcgttc cggtgagatt gctgtgtgcc       360
     gaagaagaat tggcgcgtcg cgtttcggct cccgcacggc gcgaccactt gaaaacgacc       420
     gacgtcgaga cgtcgaggag ccgaagccaa caggccgtgg ttctcaatat cccgcaccaa       480
     cacgcgctga cgttggatgt gacgctcacg tcgcccttgg aaagtgctgc ggcattacgg       540
     gatcatgttg tgacatgcct gccgaacggg cgctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page