(data stored in ACNUC7421 zone)

EMBL: CP001622.PE168

CP001622.PE168       Location/Qualifiers
FT   CDS_pept        complement(167359..168849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0169"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ret:RHE_CH00498 putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54480"
FT                   /db_xref="GOA:C6AZF4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54480.1"
FT                   /translation="MSNAAQRSNRVLIVATIMLATFMVAIEATIVATAMPRIVGELGGF
FT                   SYYSWVFSAFLLAQSTTTVIYGKLSDIFGRKPVLIGGILIFLVGSLLCGLAWSMMSLVL
FT                   FRLLQGLGAGAIQPVTTTIIGDLFKLEERGRVQGFMATVWATSAVVGPLAGGIIVDNIS
FT                   WAWIFWINLPIGVISIIAFMVFLKEDVAHKQAKIDYLGSVLFSISIVALLVMLTETDAS
FT                   AWILISLFAVFVIAGILFLAQEKRAPEPIISIPLWSRRLIATSNAATLLAGMALIGLST
FT                   ILPLYVQGVLGRSPLVAGFTLTMLVVGWPLAVMLSGRFYRAFGIQRTLRVGSLMFPFGA
FT                   CFLLFLTQESSPIVAGAGSFFMGFGMGLISLTSIVLVQDSVEWSMRGSATASIIFSRSL
FT                   GNTLGATVLGAILNAGINHYASGEAAAGLHEALNQPTGLSALAADPAIRSIFNAALHWS
FT                   FWGVVVVAVLTFFTTWLIPVGPSQKREGTAVASEAASH"
     atgtcgaatg cagcgcaacg ctcgaaccgc gtgcttatcg tcgccaccat catgctcgcg        60
     accttcatgg tggcgatcga ggcgacgatc gtagcgaccg cgatgccgcg catcgtcggg       120
     gagctcggcg gcttttccta ttatagctgg gtgttttcgg ccttcctgct ggcgcagtcg       180
     acgacgactg ttatctacgg caagctttcc gacattttcg ggcgcaagcc ggtgctgatc       240
     ggcggcatcc tgatcttcct ggtcggctct ttgctctgcg ggcttgcctg gtcgatgatg       300
     tcgctggtgc tgttccggct gctgcagggg ctgggcgccg gcgccatcca gccggtgacg       360
     acgacgatca tcggcgatct cttcaagctc gaggagcgcg gccgcgtgca gggcttcatg       420
     gcgaccgtct gggcgacgtc ggctgtcgtc gggccgctgg ccggcggcat catcgtcgac       480
     aacatctcct gggcctggat cttctggatc aacctgccga tcggcgtcat ctcgatcatc       540
     gccttcatgg tcttcctcaa ggaggacgtg gcgcacaagc aggcaaagat cgattacctc       600
     ggatcagtgc tgttttcgat ctcgatcgtc gcacttctcg tcatgctgac ggaaaccgat       660
     gccagcgcct ggatcctgat ttcgcttttc gccgtcttcg tgatcgcggg catcctcttt       720
     ctcgcccagg agaagcgggc gccggagccg atcatctcga tcccgctctg gagccgcagg       780
     ctgattgcga ccagcaatgc ggcgacgctg ctggccggca tggcgctgat cgggctttcg       840
     acgatcctgc cgctctacgt gcagggcgta cttggccgct cgcctcttgt cgcggggttc       900
     acgctcacca tgctcgttgt cggctggccc ttggcggtga tgctctccgg ccgtttctac       960
     agggccttcg gcatccagcg taccttgcgc gtcggcagcc tgatgtttcc cttcggcgcc      1020
     tgtttcctgt tgttcctgac acaggaaagc tcgccgatcg ttgccggcgc cggctccttc      1080
     ttcatgggct tcggcatggg tctcatcagc ctcaccagca tcgtgctggt gcaggacagc      1140
     gtcgaatggt cgatgcgcgg cagcgccacg gcctcgatca tcttttcccg cagcctcggc      1200
     aatacgctcg gcgccaccgt gctcggcgcc atcctcaatg ccggcatcaa ccattatgcg      1260
     agcggcgagg cggcggccgg cctgcacgag gcgctgaacc agccgaccgg gctctcggcc      1320
     ctcgccgccg atccggccat ccgctcgatc ttcaatgcgg cgctgcactg gagcttctgg      1380
     ggcgtggtcg tcgtcgcggt gctgaccttc ttcaccacct ggctgatccc ggtcgggccg      1440
     agccagaaac gcgaggggac ggctgtcgcc agcgaggcgg catcgcatta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page