(data stored in ACNUC7421 zone)

EMBL: CP001622.PE169

CP001622.PE169       Location/Qualifiers
FT   CDS_pept        complement(169109..169504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54481"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF5"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00499"
FT                   /protein_id="ACS54481.1"
FT                   /translation="MPCKFIAISLLSIGLAGPALAQTAGGADANGRLSVAPIIGGSGSS
FT                   GAGSAGAGSAGTGSVGGGATGTGSVGTGSVGTDSGTTGSTTGNGGVNLNSGRSTINPGG
FT                   VNPNLQQTPGCTSGSADTGSRGEACPQ"
     atgccctgca agttcatcgc aatatcgctg ctttcgatcg gtctggccgg cccggcgctg        60
     gcgcagacgg ccgggggtgc ggatgccaat gggcggcttt cggtggcacc gattataggc       120
     ggatcgggga gttcgggcgc cggttcggcc ggcgcggggt cggcgggcac tggttctgtc       180
     ggcggcggtg caacgggcac cgggtcggtg gggactgggt ctgtcggaac cgattccggc       240
     accaccggca gcacgactgg caatggcggc gtcaatctca acagcggccg cagcacgatc       300
     aatcccggcg gggtcaatcc caacctgcag cagacgccgg gttgcaccag cggcagcgcg       360
     gacaccggct cgcggggcga ggcatgcccg caatga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page