(data stored in ACNUC7421 zone)

EMBL: CP001622.PE17

CP001622.PE17        Location/Qualifiers
FT   CDS_pept        complement(13939..15543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0017"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rec:RHECIAT_CH0000412
FT                   apolipoprotein N-acyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54329"
FT                   /db_xref="GOA:C6AYA5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA5"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACS54329.1"
FT                   /translation="MERLADRVILVWGFKRSLLAIAAGAFAVLALPPIGFFAAMFVSFT
FT                   LLVWLIDGAAASPESGLIGRLWPAFATGWLFGFGYFVAGLWWVGHALLVDQEEFAWALP
FT                   LAILGLPACLAIFYGLAAALARIFWSDGMGRIAALAAGFGLMEWLRSVILTGFPWNAIG
FT                   YGMMPVPLMMQSAHLIGAMGVTALAVFVFSAPALAGTRQGARPGIALAVLLFAAHLGYG
FT                   AYALHLAPRPDILPEDKRPVVRLVQPAIDQTEKMDNDVDRATIFETHLKLSAEAPKNGG
FT                   RKPDIIVWPETSIPFILTDNQDALTRIADTLDDNQILIAGAVRAEEMGPGTPPRYYNSI
FT                   YVIDGRGQIIAASDKVHLVPFGEYLPFEDVLTEFGIQNVVEVPGGFSAAASRHLLALPG
FT                   GLNLYPLICYEIIFPGEMTGDIKDANAILNITNDAWFGLTPGPYQHFQQARVRAVETGL
FT                   PLIRDANNGISALVNAHGEIIAGLDLGETGFVDATLDSIGAGLGTTIPRQTYFWLTEAL
FT                   LILIALISRRGFISGLN"
     atggagcggc ttgcggacag ggttatcctc gtctggggtt tcaaacggtc gctgctggcc        60
     atcgccgccg gggccttcgc ggtgctggcg ctgccgccca tcggcttttt cgcggcgatg       120
     ttcgtttcct tcacgctgct cgtctggctg atcgacgggg cggcggcttc gcctgaaagc       180
     ggcctgatcg gcaggctgtg gccggcgttt gccaccggct ggctgttcgg tttcggctat       240
     ttcgtcgccg gcctctggtg ggttggccat gcgctgctgg tcgatcagga agaattcgcc       300
     tgggcgctgc cgctggcaat cctcgggctg ccggcctgtc ttgcgatctt ctacgggctg       360
     gcggccgccc ttgcccgcat cttctggtct gatggcatgg ggcggatcgc cgcgcttgcg       420
     gcaggcttcg ggctgatgga atggcttcga agcgtgatcc tcaccggctt tccctggaac       480
     gccatcggct acggcatgat gccggttccg ctgatgatgc agtcggcgca tctgatcggg       540
     gcgatgggcg tgacggccct tgccgtcttc gtcttttccg cgcctgccct tgccgggacg       600
     cggcaagggg cgcggccggg catcgcgctc gccgtcctgc tctttgccgc ccatctgggt       660
     tatggcgctt acgctctcca tctcgcgccg cggccggaca tattgcctga ggacaagcgg       720
     ccggtggtgc ggctggtgca gccggcgatc gaccagacag agaaaatgga taacgacgtc       780
     gaccgcgcca cgatcttcga gacgcatctg aagctctcgg ccgaagcgcc gaagaatggc       840
     gggcgcaaac ccgacatcat cgtctggccg gaaacctcga tccccttcat cctgaccgac       900
     aaccaggatg cgctgacgcg gattgccgat acgctcgacg acaatcagat cctgattgcc       960
     ggcgccgtac gcgccgagga gatgggaccg ggtacgccgc cgcgctacta taattccatc      1020
     tacgtgatcg acggccgcgg acagatcatc gccgcctccg acaaggtgca tctggtgccc      1080
     ttcggcgagt atctgccctt cgaggacgtg ctcaccgaat tcggcatcca gaacgtcgtc      1140
     gaggttccgg gcggcttttc ggccgcggca agccggcacc tgctggcgct gcccggcggg      1200
     ctcaatctct atccgctgat ctgctacgag atcatttttc ccggcgaaat gaccggtgac      1260
     attaaagacg ccaacgcaat cctcaatatc accaatgatg cctggttcgg cttgacgccc      1320
     ggcccctacc agcatttcca gcaggcgcgc gtgcgggctg tcgaaaccgg cctgccgttg      1380
     attcgcgacg ccaataacgg catttcagcg ctggtgaatg cccatgggga aattattgcg      1440
     ggcctcgatc ttggagaaac cggcttcgtc gatgcaacgc tcgatagcat cggtgcggga      1500
     cttggaacga caatcccccg gcaaacatac ttctggttga ccgaggcact gctgattttg      1560
     attgcgctaa tttctcgcag aggttttatt tccgggttga attga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page