(data stored in ACNUC7421 zone)

EMBL: CP001622.PE170

CP001622.PE170       Location/Qualifiers
FT   CDS_pept        complement(169728..170051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0171"
FT                   /product="addiction module antidote protein"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   rru:Rru_A3082 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54482"
FT                   /db_xref="GOA:C6AZF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF6"
FT                   /inference="protein motif:TFAM:TIGR02684"
FT                   /protein_id="ACS54482.1"
FT                   /translation="MALEIIPFDATEFLDTEESQAHLIEDAFESGDAGYIAHALGVVAK
FT                   ARGMSQVARDAGVTREALYKSLSEKGDPKLSTLIGVAAALGYKLTATRVGDSDTREDER
FT                   RSA"
     atggcgcttg aaatcatccc ttttgacgca accgagtttc tggacaccga agaatctcag        60
     gcccatctca ttgaagacgc gtttgaaagc ggtgatgcag gttatatcgc gcacgcattg       120
     ggcgttgttg cgaaagctcg tggcatgtca caagtcgccc gggatgccgg cgttactcgc       180
     gaggctctgt acaaatcgct cagtgaaaaa ggcgacccaa aactctcgac gctcatcggc       240
     gtagctgcag ctctcggata caagctgaca gcgacgcgtg tgggtgattc agatacgcgc       300
     gaggacgagc gccgatctgc ttag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page