(data stored in ACNUC7421 zone)

EMBL: CP001622.PE171

CP001622.PE171       Location/Qualifiers
FT   CDS_pept        complement(170053..170418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0172"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: btr:Btr_1092
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54483"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF7"
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /protein_id="ACS54483.1"
FT                   /translation="MTGGPSQHSGQQKVDYSREGVNYSSRKYTVLQTAEFQKWLRKLKD
FT                   RNARDRIVTRIVRAEAGNLGDHKFFDGIGELRLDYGPGYRLYFAMQGSVVVILLCGGDK
FT                   GSQERDIKRAIEMSKEI"
     atgacaggag ggccgtctca gcactccggt caacaaaaag ttgactactc gcgggagggt        60
     gttaattata gttcacggaa atacacggtt ctccagacag ccgaattcca gaaatggctg       120
     cgcaagctga aggatcggaa tgcaagagac cgaattgtca cgcgcatcgt tcgtgcggag       180
     gctggcaatt tgggcgacca caaattcttc gatggcatcg gggaattgag gctcgactac       240
     ggtcctgggt atcgtttgta ttttgcaatg cagggcagcg ttgtcgttat tctcctgtgc       300
     gggggcgaca agggcagcca ggagcgggac atcaagcgag caatcgaaat gtccaaggag       360
     atatga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page