(data stored in ACNUC7421 zone)

EMBL: CP001622.PE172

CP001622.PE172       Location/Qualifiers
FT   CDS_pept        complement(170415..170888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54484"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54484.1"
FT                   /translation="MRTSLLSIALFTFSLSAAQAADFPLASCAGWNGTLVSRTGTDSST
FT                   AIMKGKVTQADFREYCERDPGGETTAHGGKLTVKQCVATYTKANGKDTYRSTANCIEGT
FT                   LSFVPPRGEPLRVTFPLPEDADVSCASGMPPLIEQFKLLCPQAAREFHLMDDE"
     atgaggacat cgcttttaag tatcgcgctt ttcacattta gcttgtccgc tgcgcaggca        60
     gcagacttcc ctctcgcctc atgtgctgga tggaacggaa cgcttgtcag caggaccggc       120
     accgattcaa gcaccgcaat tatgaaagga aaggtcactc aagccgattt ccgggaatac       180
     tgcgagcgag acccaggagg tgagacaaca gcacatggcg gcaaacttac tgtaaagcag       240
     tgcgtggcaa cgtatacaaa agcgaatggg aaagacacct atcgctccac cgccaattgc       300
     atcgaaggca ccctgtcctt cgttcctcct cgtggagaac cgctgcgtgt cactttccca       360
     ttaccagagg acgcagatgt gtcgtgcgcc tcaggcatgc cgccgctgat cgagcagttc       420
     aagctcctct gccctcaggc ggcgcgggag tttcatttga tggatgacga atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page