(data stored in ACNUC7421 zone)

EMBL: CP001622.PE173

CP001622.PE173       Location/Qualifiers
FT   CDS_pept        complement(171262..172221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0174"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rec:RHECIAT_CH0000578 probable dioxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54485"
FT                   /db_xref="GOA:C6AZF9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZF9"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACS54485.1"
FT                   /translation="MALPPILKDRLRLPVIGSPLFIISHPALTLAQCKAGIVGAFPALN
FT                   VRPESQLDEWLAEITEELARHDAAHPERPAAPFAVNQIVHMSNKRLEHDLSLCVKYKVP
FT                   IVISSLGAVPEVNAAVHSYGGIVLHDIINNRHAHSAIRKGADGLIAVAAGAGGHAGTLS
FT                   PFALVQEIREWFDGPLLLAGAIATGGAILAAEAMGADMAYIGSPFIATEEARAAAAYKQ
FT                   AIVEGAASDIVYSNYFTGVHGNYLKPSILAAGMDPDNLPLADVSKMDFEQAVGGAKAWK
FT                   DIWGSGQGISAVKAVEPVAKLVDRLEAEYRAARTRLAL"
     atggccctgc ccccgatcct caaggacaga ttgagactgc cggtcatcgg ttcgccgctg        60
     ttcatcattt cgcatccagc gctgacgctg gcgcaatgca aggccggcat cgtcggagcg       120
     tttccggcgc tgaacgtccg gccggaaagc cagctcgacg aatggctggc ggagattacc       180
     gaggagctcg cccgccacga cgccgcccat ccggagcggc cggccgcccc ctttgccgtc       240
     aaccagatcg tccacatgtc gaacaagcgg ctggagcacg acctctcgct ctgcgtcaaa       300
     tacaaggtgc cgatcgtcat ctcctcgctc ggcgccgtgc ccgaagtcaa cgccgccgtg       360
     cactcctatg gcggcatcgt gctgcacgac attatcaata accgccacgc ccattcggcg       420
     atccgcaagg gtgcggacgg gctgatcgcg gtggcggccg gcgccggcgg ccatgccggg       480
     acgttgtcgc cctttgcgct cgtccaggaa atccgtgaat ggttcgacgg gccgctgctg       540
     ctggcaggcg ccatcgccac cggcggcgct attctcgccg cagaagcgat gggcgccgac       600
     atggcctata tcggctcgcc cttcatcgcc accgaggaag cccgcgccgc agccgcctac       660
     aagcaggcga tcgtcgaagg ggccgccagc gatatcgtct attccaacta tttcaccggc       720
     gtgcacggca actatctcaa gccctcgatc ctcgccgccg gcatggaccc cgacaacctg       780
     ccgcttgccg atgtctcgaa gatggatttc gagcaggctg tcggcggcgc caaggcctgg       840
     aaggacatat ggggcagcgg ccagggcatt agcgccgtca aggccgtcga gccggtggca       900
     aaactcgtcg accggttgga ggccgaatac agggcggcgc gcacccggct ggcgctctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page