(data stored in ACNUC7421 zone)

EMBL: CP001622.PE174

CP001622.PE174       Location/Qualifiers
FT   CDS_pept        172508..173692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0175"
FT                   /product="putative transcriptional regulator protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000580 putative transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54486"
FT                   /db_xref="GOA:C6AZG0"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000580"
FT                   /protein_id="ACS54486.1"
FT                   /translation="MSGLETAIRTALENSDRDNPEVRARIYQSARQALEAGLRKQDITD
FT                   TEVVAHHRHRLESTIHAIEGEERDRLHPRQRPPEVPVPPVVEMPAPPVHQAEADEFDGP
FT                   MVSGETRAPEVMHRGDESSLDDVHAGNTDHLAAAPVGEERLARGQRATNMDFRPERAAG
FT                   RRKPRKFFSRLLVWCVLLAFIGIGAWWAHTSGLLMTAAERDTSVANPPASTQPEDFTGN
FT                   DDSAGNAASHTDEPVTIDPQNSFSADWIPLFKPEDADKIQSGPRARTEKIAENDGPAVR
FT                   LISESGAADGNVSISVPPSVLQQLAGKSSTIALTLQSTTDEPTQITVECNFQTLGNCAR
FT                   HRFTVTREKSDALLQVKFDRSLAPNSPGTLTINSDLDGKARGINLFAIRILPGQ"
     gtgagcggat tagaaacggc catcagaacg gcgctcgaga attccgatcg cgataatcca        60
     gaggttcgag cgaggatcta tcagtcggcc cgccaggcgc tggaagccgg gctgcgcaag       120
     caggatatca ccgacaccga ggtcgtcgcc catcaccgcc accgcctgga aagcaccatc       180
     cacgccatcg aaggcgagga gcgcgaccgc cttcatcccc gccagagacc gcctgaagtg       240
     cccgtgccgc cggtcgtgga aatgccggcg ccgccggttc accaggccga agccgatgag       300
     ttcgacggcc cgatggtgtc aggcgagacc cgcgcgcctg aggttatgca ccgcggcgac       360
     gagtccagcc tcgacgacgt gcatgccggc aatacagatc atctggctgc cgcccccgtc       420
     ggcgaggagc gccttgcccg tggtcagcgc gccaccaata tggatttccg cccggagcgg       480
     gcggcaggcc ggcgcaagcc acgcaaattc ttttcgaggc tgctcgtctg gtgcgtcctg       540
     ctggccttca tcggcatcgg cgcctggtgg gcgcatacgt caggcctatt gatgacggcg       600
     gccgagcgcg acaccagcgt cgccaatccg ccggcaagca cgcaaccgga ggattttacc       660
     ggcaatgacg acagcgccgg caatgccgct tctcacaccg atgagccggt gaccatcgat       720
     ccgcagaaca gtttctcggc cgattggatc ccgctgttca agcctgagga cgccgacaag       780
     atccagagcg gcccgcgggc gcgcaccgaa aaaatcgccg agaatgacgg tcctgccgta       840
     cggctgattt ccgaaagcgg tgcggccgat ggcaatgtct cgatcagcgt gccgccatcg       900
     gtgctgcagc agctggccgg aaaatcctcg acgatcgcgc tgacgctgca gtccaccacc       960
     gacgagccga cgcagatcac cgtcgaatgc aatttccaga cgctcggcaa ttgcgcccgt      1020
     caccgcttta ccgtcacccg ggaaaagtcg gatgcgctgc tgcaggtgaa gttcgaccgc      1080
     tcgctggcgc cgaattcgcc gggcacgctg acgatcaaca gcgatctcga cggcaaggcg      1140
     cgcggcatca acctcttcgc catacgcatc ctgccggggc agtaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page