(data stored in ACNUC7421 zone)

EMBL: CP001622.PE175

CP001622.PE175       Location/Qualifiers
FT   CDS_pept        complement(173746..174627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0176"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ret:RHE_CH00507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54487"
FT                   /db_xref="GOA:C6AZG1"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG1"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACS54487.1"
FT                   /translation="MDEDIENRAVELEIRGKKRTFDVDDPALPNWVDEHALESGDFPYK
FT                   KKLKEEDYLEELEKLQIELVKVQFWLQATGKRVMALFEGRDAAGKGGAISASSAHMNPR
FT                   LARVVALTKPTEREQGQWYFQRYVAQFPTAGEFVLFDRSWYNRAGVEPVMGFCTPQQYE
FT                   DFLKQTPQLEKIIAHEGIFFFKFYLDIGREMQLKRFHDRRHDPLKVWKLSSMDIAALTK
FT                   WGDYSEKRDRMLKETHTDFAPWTVIRANDKRRARLELIRHMLNKMDYDGKDKKALGTVD
FT                   EEIIGSGLGFLK"
     atggacgagg acatcgaaaa cagggccgtg gagctggaga tccgcggaaa gaaacgcacc        60
     ttcgatgtcg acgaccccgc cctgccgaac tgggtggacg agcacgcgct ggaatccggc       120
     gacttccctt acaagaagaa gctcaaggaa gaggactatc tggaggagct ggagaagctg       180
     cagatcgaac tagtcaaggt gcagttctgg ctgcaggcga ccggcaagcg ggtgatggcg       240
     ctgttcgagg gccgcgatgc ggccggcaag ggcggcgcga tctcggcctc ctcggcgcat       300
     atgaacccac gccttgcgcg cgtcgtggcg ctgacaaagc cgaccgagcg cgaacagggg       360
     caatggtatt ttcagcgtta tgtggcgcag tttccgaccg ctggcgaatt cgtgctgttc       420
     gatcgctcct ggtacaaccg cgccggcgtc gagccggtca tgggtttctg cacgccgcag       480
     caatatgagg atttcctcaa gcagacgccg cagctcgaaa agatcatcgc ccatgagggc       540
     atcttcttct tcaaattcta tctcgatatc ggccgcgaga tgcagctcaa acgtttccac       600
     gaccgtaggc acgatccgct gaaagtctgg aaactgtcgt cgatggatat cgcggcgctg       660
     accaaatggg gcgactacag cgaaaagcgc gaccggatgc tgaaggaaac ccatacggat       720
     ttcgcgccct ggacggtgat ccgcgccaat gacaagcggc gggcgcgcct cgaactcatc       780
     cgccacatgc tgaacaagat ggattatgac ggcaaggaca aaaaggcgct cggcacggtc       840
     gacgaggaga tcatcggctc agggctaggc ttcctgaaat ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page