(data stored in ACNUC7421 zone)

EMBL: CP001622.PE176

CP001622.PE176       Location/Qualifiers
FT   CDS_pept        174871..176094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0177"
FT                   /product="histidine kinase"
FT                   /note="KEGG: ret:RHE_CH00508 phosphate regulon,
FT                   two-component sensor histidine kinase protein; TIGRFAM:
FT                   phosphate regulon sensor kinase PhoR; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54488"
FT                   /db_xref="GOA:C6AZG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG2"
FT                   /inference="protein motif:TFAM:TIGR02966"
FT                   /protein_id="ACS54488.1"
FT                   /translation="MARIRRERPVLLAAILSALAALAAGMNKWVVLALLLVMILTALFN
FT                   EAPVIEAEPALPVEIKPEAPPSRLPEVSATLSGLDIPVMLLSEDASVLFQNRAAEKAFG
FT                   EVALGAHISARMRSPGVLDMVRETIATNAPNQIEHSERLPSERVYIVRSAPIEFAAEDG
FT                   PRERYFILSFRDISEVRRIDRMRSDFVANASHELRTPLASLRGFIETIQGPAKNDLKAQ
FT                   TRFLNIMLDQATRMSRLVDDLLSLSRLELKSHIAPDEKIDLVPLLGHVRDSLVPLAKDV
FT                   GVDINLHLPEGKVEVLGDRDELVQVFENLMENACKYGQEGEIVDVWLKNGTGQPVEVSI
FT                   VDKGPGIPAEHVPRLTERFYRVSIEDSRSKKGTGLGLAIVKHILTRHRARLIVKSEVGK
FT                   GTDFTVRF"
     ttggcgcgca taaggcgcga acggccggtg ctgcttgcgg cgatcctcag cgcgctcgcg        60
     gcgcttgccg ccggcatgaa caagtgggtt gtgctcgccc tgctgcttgt gatgatcctc       120
     accgcgctgt tcaatgaggc gcccgtcatc gaggcagaac ccgccctgcc ggtggaaatc       180
     aagccggagg cgccgccaag ccgcctgccg gaagtttccg ccacactttc gggcctcgat       240
     atccccgtca tgctgctgtc ggaagacgcc tcggtgctct tccagaaccg cgctgccgaa       300
     aaggccttcg gcgaggtggc gctcggcgcc catatatcgg cccgtatgcg ttcgcccggc       360
     gtgctcgaca tggtgcgcga aaccatcgcc accaacgcgc cgaaccagat cgagcattcc       420
     gagcggctgc cctccgagcg cgtttatatc gtgcgcagcg cccccattga attcgccgct       480
     gaggacggtc cacgtgagcg ctatttcatc ctctccttcc gcgatatatc ggaggtccgc       540
     cgcatcgacc gcatgcgctc ggatttcgtc gccaatgcca gccatgagct gcgcacgccg       600
     cttgcctcgc tgcgcggctt catcgagacc atccaggggc cggcgaagaa cgatctgaag       660
     gcgcagacgc gtttcctcaa tatcatgctc gatcaggcga cgcgcatgag caggctggtc       720
     gacgacctgc tgtcgctctc ccgtctggag ctgaaatcgc acatcgcgcc tgatgagaag       780
     atcgatctgg tgccgctgct cggccatgtc cgggattcac tggtgccgct ggcaaaggat       840
     gtcggcgtcg acatcaacct gcatttgccg gaaggcaagg tcgaggtgct gggcgaccgc       900
     gacgaacttg tccaggtctt cgagaacctg atggaaaatg cctgtaaata cggccaggag       960
     ggcgagatcg tcgatgtctg gctgaagaac ggcaccggcc agccggtcga ggtcagcatc      1020
     gtcgacaagg ggccgggcat tccggccgag catgtaccgc gcctgaccga acgcttctac      1080
     cgagtcagca tcgaggacag ccgctcgaaa aagggcaccg gcctcggcct tgccatcgtc      1140
     aagcacatcc tcacccgcca ccgcgcgcgg ctgatcgtca agtcggaagt cggcaagggc      1200
     actgatttta ccgtccgttt ctga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page