(data stored in ACNUC7421 zone)

EMBL: CP001622.PE177

CP001622.PE177       Location/Qualifiers
FT   CDS_pept        176678..177712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0178"
FT                   /product="phosphate ABC transporter, substrate-binding
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000584 phosphate ABC
FT                   transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54489"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000584"
FT                   /protein_id="ACS54489.1"
FT                   /translation="MNTFKLTVAALAATAAFAGAAVARDQIQVAGSSTVLPYAKIVAES
FT                   FGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIANASRPINKNEAEACKAAGVTDI
FT                   QEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVDGKLVANPYKKWSEVNPKLPA
FT                   VDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEIADKAAQGKACVAVRKDGVA
FT                   VDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVASMSGIVPSTETIANGTYPVS
FT                   RPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYGLVAAPDAERDAIRKDVEA
FT                   GKSM"
     atgaacacct ttaagctcac cgttgccgcg ctcgccgcaa ctgctgcttt cgctggcgct        60
     gccgtcgccc gcgaccagat tcaggttgct ggttcgtcca ccgtcctgcc ttacgcaaag       120
     atcgttgccg agtccttcgg cgaaaccttc accaacttca agacgccggt cgttgaatcc       180
     ggcggcacgg gcgctggtct gaaggaattc tgcaagggcg ttggcgaaga caccatcgac       240
     attgccaacg cttcgcgtcc gatcaacaag aacgaagccg aagcctgcaa ggctgccggc       300
     gtaaccgaca tccaggaagt caagatcggc tacgacggca tcgtcttcgc aaccgacgct       360
     tccaaccctg acgtcgccta cgttcctgcc gacatctaca aggccctcgc agcccaggtc       420
     gtcgtcgacg gcaagctcgt cgccaaccct tacaagaagt ggtcggaagt caacccgaag       480
     cttccggctg ttgatatcgc tgcctacatc ccgggcgaaa agcacggcac ccgcgaagtt       540
     ttcgaacaga acgttctcgc cgccggctgc aaggcttcgg gcgcaactga cgtcatcgcc       600
     aaggaaatcg ccgacaaggc tgcccagggc aaggcctgcg tcgcagtccg caaggacggc       660
     gttgccgttg acatcgacgg cgactatccg gaaaccctcg cacgcatcgc cgccaataag       720
     accggcgtcg gcgtattcgg cctttccttc tatgaaaaca atgccgacaa gctcaaagtt       780
     gcgagcatga gcggtatcgt tccgtccacc gaaacgatcg ccaacggcac ctacccggtt       840
     tcccgcccgc tgttcttcta cgtcaagaag gcacatctcg gcgctgttcc gggcctgaag       900
     gaatacgtca acttcttcgt atccgaccag atgatcggcc ccgacagccc gctcgtcgaa       960
     tacggcctcg ttgccgctcc ggacgcagag cgcgacgcaa tccgcaagga cgtcgaagca      1020
     ggcaagtcca tgtaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page