(data stored in ACNUC7421 zone)

EMBL: CP001622.PE178

CP001622.PE178       Location/Qualifiers
FT   CDS_pept        177883..179364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0179"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG:
FT                   rec:RHECIAT_CH0000585 phosphate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54490"
FT                   /db_xref="GOA:C6AZG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG4"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACS54490.1"
FT                   /translation="MSTSIILLCLVVIGAAAYLVARIRATALAGGRSSALHSRPVYYGA
FT                   YAAIWAVLPALLVLCLWLSISPGIIQSSVRGAFPDDIKAQAAVEQDLGYSTVATVARGM
FT                   TMLTSDETAAVANDPAALQAKLLEKGVPLASQPLPYMLDAAKKLNAMSMTSRIAMTAIV
FT                   FALAVAGAFYALRSIAPRFRARNRVERVMLWGLLLASSIAILTTIGIVFSMLSEAARFF
FT                   AAVPAMDFFFGTVWDPRFAGAGSSSFGQFGLIPLLLGTIYIGLVAMLVAVPVGLFAAIY
FT                   MAEYASPKLRGVAKPLLEVLAGIPTIVYGFFALVTVGPFLRDFSAQISGLLSGNYSNFI
FT                   QAQSVLTAGIVMGIMLIPYVSSLSDDIITAVPRTLRDGSLGLGATRSETIKKVVLPAAL
FT                   PGIVGALLMTASRAIGETMIVVLAAGVAARIQINPFEPMTTVTVKIVNQLTGDLEFTSP
FT                   QTLVAFALGITLFCITLCLNIYALYIVRKYREQYE"
     atgagcacat ccatcatact tttgtgcctt gtggtgatcg gtgccgccgc ctatctggtc        60
     gcgcgcattc gtgccacggc gcttgccgga ggccgatcct ccgcattgca ttcacggccg       120
     gtctattacg gcgcctatgc ggcgatctgg gcagttcttc ccgccctgct cgtcctctgc       180
     ctctggctct ccatcagccc cggcatcatc cagtcctcgg ttcgcggtgc tttccccgac       240
     gacatcaaag cgcaagccgc agtcgagcag gatctcggct attcgacggt ggcgacggtt       300
     gcccgcggca tgacgatgct gacctcggat gaaactgccg cggtcgccaa cgatccggct       360
     gccctgcagg ccaagctcct cgaaaagggc gtgccgcttg ccagccagcc gctgccttac       420
     atgctcgacg ccgccaaaaa gctcaacgcg atgagcatga cgagccgcat cgccatgacg       480
     gcgatcgtct tcgctctcgc cgttgccggc gccttctatg cgctgcgttc catcgctccg       540
     cgcttccgcg cccgcaaccg ggtcgagcgc gtcatgctct ggggcctgct gcttgcctcc       600
     tcgatcgcca tcctgacgac gatcggcatc gtcttctcca tgctgtcgga agccgcccgc       660
     ttctttgcgg ccgttcccgc catggacttc ttcttcggca ccgtctggga tccacgcttt       720
     gccggcgccg gcagctcgtc cttcggccag ttcggcttga tcccgctgct gctcggcacg       780
     atctatatcg gtctggtcgc catgctggtc gccgtgccgg tcggcctctt tgccgccatc       840
     tacatggccg aatacgcctc gccgaagctg cgcggcgtcg ccaaaccgct cctcgaagtg       900
     ctcgccggca ttccgacgat cgtctacggc ttcttcgcgc tcgtcaccgt cggcccgttc       960
     ctgcgcgatt tctctgccca gatcagcggc cttctgtccg gcaactacag caacttcatc      1020
     caggcgcaga gcgttctgac ggccggcatc gtcatgggca tcatgctgat cccttacgtc      1080
     tcctcgctgt cggacgacat catcaccgcc gtgccgcgga ccttgcgtga cggttcgctc      1140
     ggtcttggtg ccacacgctc cgaaaccatc aagaaagtgg ttttgccggc cgctcttccc      1200
     ggcattgtcg gcgccttgct gatgaccgcc tcgcgcgcca tcggcgaaac catgatcgtc      1260
     gtgctggccg ccggtgtcgc cgcccgcatc cagatcaacc ccttcgagcc gatgacgacg      1320
     gtgaccgtca agatcgtcaa ccagctgacc ggcgaccttg agttcacctc gccgcagacg      1380
     ctggttgcct tcgcccttgg catcaccctg ttctgcatca cgctttgcct caatatctat      1440
     gcgctctaca tcgtgcgcaa ataccgggag cagtacgaat ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page