(data stored in ACNUC7421 zone)

EMBL: CP001622.PE179

CP001622.PE179       Location/Qualifiers
FT   CDS_pept        179361..180683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0180"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ret:RHE_CH00511
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54491"
FT                   /db_xref="GOA:C6AZG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG5"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACS54491.1"
FT                   /translation="MTDIVSPTSGVTVSKAPVRRDIGIKRRYAAERRFQAYGIAAITFG
FT                   LVFLFILLWTVIGKGYTAFQQTAITLPIEFSEKTIDPNNKRATDPSVLIAANYPVLLRD
FT                   AIVKQLNVNAASRPDVRDASAMLSKGAPVQLRDMVVADPSIIGKTVNVTVLADANVDSA
FT                   NKGQIDLSVDEKNRKVNDKQVGWMNELKASGALHKQFNTGLFVNGNSSRPEAAGLGVAL
FT                   IGSLYLMLIVLVLALPIGVAASIYLEEFAPKNKLTDLIEVNINNLAAVPSIVYGLLGLS
FT                   VFINFIGLPRSASLVGGLVLTLMTLPTIIIATRAALRAVPPSIRAAALGLGASKMQMVF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVANAPTTPLDPSTALPVQVYMW
FT                   ANEAERAFVERTSGAIIVLLLFLIVMNMGAILLRRRFERRW"
     atgacggata ttgtttctcc cacatcaggc gtcaccgttt ccaaggcgcc ggtgcgccgc        60
     gatatcggca tcaagcgccg ctatgccgcc gagcgccggt tccaggccta tggcatcgcc       120
     gccatcacct tcggtctcgt cttcctgttc atcctgctgt ggacggtgat cggcaagggc       180
     tataccgcct tccagcagac ggcgatcacc ctgccgatcg aattctccga gaagacgatc       240
     gacccgaaca acaagcgtgc gaccgaccct tcggtgttga tcgccgccaa ttatccggtt       300
     ctcctgcgcg acgcgatcgt caagcagctg aacgtcaatg ccgcgagccg tcccgatgtg       360
     cgcgatgcat ccgccatgct ctccaagggt gcgccggtcc agctgcgcga catggtcgtc       420
     gccgatccgt ccatcatcgg caagacggtc aatgtcacgg tgcttgccga cgccaatgtc       480
     gacagcgcca acaagggcca gatcgatctg tcggtcgatg agaagaaccg caaggtcaac       540
     gacaagcagg tcggctggat gaacgagttg aaggcgagcg gcgctctcca caagcagttc       600
     aataccggcc tcttcgtcaa cggcaattcc agccgtccgg aggccgcggg cctgggcgtc       660
     gccctgatcg gctcgctcta cctgatgctg atcgtcctcg tgcttgctct gccgatcggc       720
     gtcgccgcct cgatctatct cgaggagttc gcaccgaaga acaagctgac ggacctgatc       780
     gaggtcaaca tcaacaacct cgctgcggtc ccctcgatcg tctacggtct gctcggtctt       840
     tccgtcttca tcaacttcat cggcctgccg cgctcggcct cgctggtcgg cggcctggtg       900
     ctgacgctga tgaccctgcc gacgatcatc atcgcgacgc gcgccgccct tcgcgccgtg       960
     ccgccgtcga tccgcgccgc ggccctcggc ctcggcgctt cgaagatgca gatggtgttc      1020
     caccatgttc tgccgctcgc catgcccggc atcctcaccg gcacgatcat cggcctggcg      1080
     catgcgctcg gcgaaaccgc gccgctgctt ctgatcggca tggtcgcctt cgtcgccaac      1140
     gcgccgacga caccgctcga tccctcgacg gctctgcccg tacaggtcta tatgtgggcc      1200
     aacgaggccg aacgtgcctt cgttgagcgt acttcgggtg ccatcatcgt cctgctcctg      1260
     ttcctgatcg tcatgaacat gggcgccatc ctcttgcgtc gtcgcttcga gcgccgctgg      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page