(data stored in ACNUC7421 zone)

EMBL: CP001622.PE18

CP001622.PE18        Location/Qualifiers
FT   CDS_pept        15910..17172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0018"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   SMART: adenylyl cyclase class-3/4/guanylyl cyclase; KEGG:
FT                   rec:RHECIAT_CH0001286 probable adenylate cyclase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54330"
FT                   /db_xref="GOA:C6AYA6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA6"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACS54330.1"
FT                   /translation="MLLPVENNTVAARGTDKLVHGAEVASASPIIDWLAGDECHALDEA
FT                   GVISGLGRRLRAIGVPVDRLALYLITLHPEYFGRSIAWTEEEPVDIEDRQHGTISLAFM
FT                   DSAISHAMRTRRTVVVGRSGVGASWQCLRTLADRNLEQLIVSPLCNSDGPVSTASFATR
FT                   KPTGFTDIERQIIQRVSPALRNVCELLTLRKVGNTMLDTYIGPYTAQRVRAGHIRQGEV
FT                   ESIDAALLLCDLRGFTKLSNRLPPQEVMQFVNCYYDKVVPSITGNGGEVAKFMGDAVLA
FT                   FFPAYSAEWAAASAYNAAIEISTRTAEATGIKMDVGIALHYGIVNYGNIGSGGRLDFTL
FT                   IGPDVNLVNRIQHVCSEESRQLLMSRSFVEAHIGCERLPIGHRQLKGFERPVELFQGPE
FT                   LDRKLTIDVPHSGSISKQACS"
     atgcttctac ccgtggagaa taataccgtt gctgctcggg gcacggacaa actggtgcat        60
     ggcgccgagg tcgcctcggc ttcgccgatt atcgattggc tggccggaga cgaatgccat       120
     gcactggatg aggcaggggt catttcagga ctgggccgcc gacttcgagc aattggagta       180
     ccagtcgatc gattggcact ctaccttata acgctgcatc cagaatattt cggtaggagc       240
     attgcctgga cggaggaaga acccgtcgat atcgaggacc gccaacacgg gaccattagc       300
     ctggcgttca tggatagcgc aatatctcac gcaatgcgga cgagaagaac agtcgtggtt       360
     ggccgtagcg gcgtcggagc aagctggcag tgtctgagga ccctcgcgga tcgcaacctc       420
     gagcaattga tcgtctcacc tctctgcaat tctgacggcc cggttagcac cgcctctttt       480
     gcgacgcgaa aaccgaccgg ctttaccgac attgagcgcc aaatcattca gcgcgtttcg       540
     cccgcgcttc gtaacgtctg tgaactactg acgcttcgaa aagtggggaa caccatgctt       600
     gatacgtaca tcggccccta cacggcgcaa cgtgttcggg ctggccacat acggcaaggc       660
     gaggttgagt ccatcgacgc ggcgttgctg ctttgcgacc tgcggggttt caccaaactt       720
     tccaaccgcc tgccacccca ggaggtcatg caattcgtca attgttacta cgataaggtc       780
     gtaccttcga ttacaggcaa cggtggtgaa gtcgccaagt tcatgggaga tgccgttttg       840
     gctttcttcc cggcgtatag tgccgaatgg gcggcagcct ccgcttataa cgccgcgata       900
     gaaatctcga cccgaacggc agaagccacc ggtatcaaga tggatgttgg catcgcgctg       960
     cactatggca tcgtcaacta tggaaacatc ggctccggcg gccgtcttga tttcacgttg      1020
     atcggaccag acgtcaatct ggtgaaccgg atacaacatg tttgcagcga ggaaagtcgc      1080
     caactgctga tgtcgcgttc atttgtggaa gcacacattg gttgtgagcg ccttcccatc      1140
     gggcatcgcc aattgaaggg tttcgaaaga cccgttgagc tctttcaagg cccagagttg      1200
     gatcgcaagc tgacgatcga cgtgcctcat tccggaagca tatccaaaca agcttgctct      1260
     taa                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page