(data stored in ACNUC7421 zone)

EMBL: CP001622.PE180

CP001622.PE180       Location/Qualifiers
FT   CDS_pept        180700..181515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0181"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000587 phosphate ABC
FT                   transporter, ATP-binding protein; TIGRFAM: phosphate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54492"
FT                   /db_xref="GOA:C6AZG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG6"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACS54492.1"
FT                   /translation="MNMLTEAAVEKALDHKMSNVPYKMIGKDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRSLNRMNDTIDGCRVTGKITLDTDDIYDPDIDVVELRA
FT                   RVGMVFQKPNPFPKTIYENVSYGPRIHGLAKSKADLDQIVETSLQRAGLWNEVKDRVHE
FT                   SGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRENYTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDPRTQDYIMGRFG"
     atgaacatgt tgacggaagc tgcagttgaa aaggcgctgg atcacaagat gagcaacgtc        60
     ccgtataaga tgatcggaaa ggatgtctcg gtttactacg gcgaaaagcg cgcgctattc       120
     gatgtgaacc tgaacatccg cgaaaacacc gtaaccgccc tgatcggccc gtccggctgc       180
     ggcaagtcga ccttcctgcg tagcctcaac cgcatgaacg acacgatcga cggctgccgc       240
     gtcaccggca agatcacgct ggataccgac gatatctatg atcccgatat cgacgtcgtc       300
     gaacttcgtg cccgcgtcgg catggtcttc cagaagccga acccgttccc gaagacgatc       360
     tatgaaaacg tctcctatgg cccgcgcatc catggccttg ccaagtcgaa ggccgatctc       420
     gaccagatcg tcgagaccag cctgcagcgc gccggtctct ggaacgaggt caaggaccgc       480
     gtgcacgaat ccggcaccgg cctgtcgggc ggtcagcagc agcgcctctg cattgcccgt       540
     gccgtcgccg tcagcccgga agtcatcctg atggacgagc cctgctcggc gctcgacccg       600
     atcgccaccg ccaaggtcga ggagctgatc cacgagctgc gcgagaacta cacgatcgtc       660
     atcgtcaccc attccatgca gcaggccgcg cgtgtttcgc agcgcaccgc catgttccac       720
     ctcggcaatc tcgtcgagga gaacgacacc gacaagatgt tcaccaatcc cgacgatccg       780
     cgcacccagg actatatcat gggtcgcttc ggctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page