(data stored in ACNUC7421 zone)

EMBL: CP001622.PE181

CP001622.PE181       Location/Qualifiers
FT   CDS_pept        181560..182273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0182"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   rec:RHECIAT_CH0000588 phosphate uptake transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54493"
FT                   /db_xref="GOA:C6AZG7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG7"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ACS54493.1"
FT                   /translation="MASTHIYSAYDDDLKFLSRRISEMGGLAEQMVAEAVRALVNGDTA
FT                   LAQKVISDDVILDHAEREIGDKAIVTIARRQPMAADLREIMGSIRIAADLERVGDLGKN
FT                   TAKRVIAVQSTGVPRKLARGLEHLSELALVQLKEVLDVYTNRSADKANAIRERDNEIDA
FT                   MYTSLFRELLTYMMEDPRNITSCTHLLFCAKNIERIGDHATNIAETIYYMTTGAQPEGD
FT                   RPKDDSANTVGAVTE"
     atggcatcga cacatattta ttctgcctat gatgatgatc tgaagttcct gtccaggcgg        60
     atttccgaaa tgggcggcct ggccgagcag atggtcgccg aagccgtacg ggcgctcgtc       120
     aacggcgata ccgcgctggc gcagaaggtc atctccgacg atgtgatcct cgatcacgcc       180
     gaacgcgaaa tcggcgacaa ggcgatcgtc accatcgccc gccgccagcc gatggccgcg       240
     gacctgcgcg aaatcatggg ttcgatccgc atcgccgccg atctcgaacg cgtcggcgac       300
     ctcggcaaga acactgccaa gcgcgtcatc gccgtccaaa gcaccggcgt tccccgcaag       360
     ctcgcccgcg gcctcgagca tctgtccgag ctggcgctcg tccagctcaa ggaagtgctc       420
     gacgtctaca ccaatcgttc cgccgacaag gcgaatgcga tccgcgaacg cgacaacgag       480
     atcgacgcga tgtacacctc gctgttccgc gagctcctga cctacatgat ggaagatccg       540
     cgcaacatca ccagctgcac gcatcttctc ttctgcgcca agaacatcga gcgcatcggc       600
     gaccacgcca ccaacatcgc cgagacgatc tattacatga cgacaggcgc gcagccggaa       660
     ggcgatcggc cgaaggacga cagcgccaac accgtcggcg cggtcaccga ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page