(data stored in ACNUC7421 zone)

EMBL: CP001622.PE182

CP001622.PE182       Location/Qualifiers
FT   CDS_pept        182408..183091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0183"
FT                   /product="two component transcriptional regulator PhoB,
FT                   winged helix family"
FT                   /note="KEGG: rec:RHECIAT_CH0000589 phosphate regulon,
FT                   two-component response regulator protein; TIGRFAM:
FT                   phosphate regulon transcriptional regulatory protein PhoB;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54494"
FT                   /db_xref="GOA:C6AZG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG8"
FT                   /inference="protein motif:TFAM:TIGR02154"
FT                   /protein_id="ACS54494.1"
FT                   /translation="MIPRVAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEMRLQER
FT                   TPDLLILDWMLPGVSGIELCRRLRMRPETERLPIIMLTARGEESERVRGLSTGADDYVV
FT                   KPFSTPELVARVKAMLRRARPEVLSTVLKCGDIELDRETHRVHRKTREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAG
FT                   YSMEA"
     atgatcccga gagttgcagt tgttgaagac gaggaagccc tcagcgtgct tcttcgctac        60
     aatctcgaag cggaaggctt cgaggtcgat accatccttc gtggcgacga agccgaaatg       120
     cggcttcagg agcgcacgcc cgatcttctc atccttgatt ggatgctgcc cggcgtctcc       180
     ggcatcgagc tctgccggcg cctgcgcatg cggccggaga ccgagcgtct gccgatcatc       240
     atgctgacgg cgcgcggcga agagagcgag cgtgtccgcg gattgtcgac gggcgccgac       300
     gattatgtcg tcaagccctt ttcgaccccc gaactcgttg cccgcgtcaa ggcgatgctg       360
     cgtcgcgccc gtcccgaggt gctgtcgacg gtgctgaaat gcggtgacat cgagctcgac       420
     cgtgagaccc atcgcgtcca tcgcaagacc cgcgaagtcc gcctcggccc caccgaattc       480
     cgcctgctgg aattcctgat gtcgtcgccg ggccgggtct tctcccgctc acagctgttg       540
     gatggtgtct ggggccacga tatctatgtc gacgagcgca ccgtcgacgt ccatgtcggc       600
     cgcctgcgca aggcgctgaa tttctccaac atgcaggacg tcatccgcac cgtccgcggc       660
     gccggttatt cgatggaagc ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page