(data stored in ACNUC7421 zone)

EMBL: CP001622.PE183

CP001622.PE183       Location/Qualifiers
FT   CDS_pept        complement(183334..183867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0184"
FT                   /product="GcrA cell cycle regulator"
FT                   /note="PFAM: GcrA cell cycle regulator; KEGG:
FT                   rec:RHECIAT_CH0000590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54495"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZG9"
FT                   /inference="protein motif:PFAM:PF07750"
FT                   /protein_id="ACS54495.1"
FT                   /translation="MNWTDERVEKLKKLWAEGLSASQIAAQLGGVSRNAVIGKVHRLCL
FT                   PGRAKAGGTNTAARTPKRNTSAPRAPNFASRITTRTVTRQQGATMLKEEIEIETIEEME
FT                   YVPRGNVVVPISRRLGLTELTERTCKWPVGDPLKDDFHFCGCESPDNSPYCGYHQKLAY
FT                   QPVNERRRAAARAS"
     atgaactgga cagacgagcg ggtcgagaaa ctcaagaagc tttgggccga aggactgagc        60
     gcgagccaga tcgcggcaca acttggcggt gtcagccgaa acgcggtcat cggtaaagtg       120
     caccggctgt gccttcccgg ccgtgccaag gccggcggca ccaacaccgc ggcgcgaacg       180
     ccgaagcgca atacatcggc gccgcgcgcg ccgaacttcg cctctcgcat caccacccgc       240
     accgtcaccc gccagcaggg cgcgacgatg ctgaaggaag agatcgagat cgaaacgatc       300
     gaggaaatgg aatacgtgcc gagaggcaat gtggtggtgc cgatttcccg ccgcctcggc       360
     ctgacggaac tgaccgaacg cacctgcaag tggccggtcg gcgatccgct gaaggatgac       420
     ttccatttct gcggctgcga gtcccccgac aattcgccct attgcggtta tcaccagaag       480
     cttgcctacc agccggtgaa tgaacgccgc cgggcagcgg cgcgggccag ctga             534
//

If you have problems or comments...

PBIL Back to PBIL home page