(data stored in ACNUC7421 zone)

EMBL: CP001622.PE184

CP001622.PE184       Location/Qualifiers
FT   CDS_pept        184288..185487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0185"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: rec:RHECIAT_CH0000591 acetylornithine
FT                   transaminase protein (diaminobutyrate--pyruvate
FT                   aminotransferase); TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54496"
FT                   /db_xref="GOA:C6AZH0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH0"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACS54496.1"
FT                   /translation="MAEAAPLYDTYSRAPLRFERGEGVWLITETGERYLDFGAGVAVTS
FT                   VGHSNPHVVGALKEQADKVWHLSNIYEIPGQERLAKRLTDATFADKVFFTNSGAEALEC
FT                   AIKTARRYQFSKGHPERFHIITFEGAFHGRTLATIAAGGQEKYLEGFGPKAPGFDQVAF
FT                   GDIEAVRAAITDATAGILIEPVQGEGGVRPATPEFMKALRQLCDENGLLLILDEVQTGV
FT                   GRTGKLFAHEWSGVTPDIMAVAKGIGGGFPLGACLATSEAASGMKAGTHGSTYGGNPLA
FT                   MAVGSAVLDIILADGFLQQVRDVALVFRQGLASLKDRYPDVIEDVRGEGLLLGIKAAVP
FT                   SAELLQAIRAAHLLGVPAGDNVIRLLPPLVVTAEEAREGLSRVERAAESIRASKVKKTA
FT                   "
     atggctgaag ccgcgccgct ttatgacacc tattctcgtg ccccgctgcg gttcgagcga        60
     ggcgagggcg tatggctgat caccgaaact ggcgagcgat atctcgattt cggcgccggc       120
     gtcgccgtca cctccgtcgg ccacagcaat ccgcatgtgg tcggcgcact gaaggagcag       180
     gcagacaagg tctggcacct gtcgaacatc tatgagatcc ccggccagga gcgtctggca       240
     aaacggctga cggacgctac cttcgccgac aaggtgttct tcaccaattc gggcgccgag       300
     gcgctcgaat gcgcgatcaa gacggcgcgc cgctaccagt tttccaaggg ccatcccgag       360
     cgcttccata tcatcacctt cgaaggcgcc ttccacggac ggacgctggc gacgatcgcc       420
     gccggtggcc aggaaaaata tctcgaaggt ttcggcccca aggcgccggg tttcgatcag       480
     gtggctttcg gcgacatcga agcggtccgc gccgcgatca ccgatgccac ggctggcatc       540
     ctcatcgagc cggtgcaggg cgagggcggc gtccgtcctg ccacgcctga gttcatgaag       600
     gcgcttcgcc agctctgcga cgagaacggc ctgctgttga tcctcgacga agtccagacc       660
     ggcgtcggcc gcaccggcaa gctcttcgcc catgaatggt cgggcgtcac ccccgacatc       720
     atggctgtcg ccaagggcat cggcggcggt ttcccgctcg gcgcctgcct tgccacatca       780
     gaggccgcct ccggcatgaa ggccggtacg catggctcga cctatggcgg caatccgctt       840
     gccatggccg tcggcagcgc cgtgctcgac atcatccttg ccgatggctt cctccagcag       900
     gtgcgcgacg tagcacttgt cttccgccag ggcctcgcct cgctgaagga tcgttatccc       960
     gatgtgatcg aggacgtgcg cggcgaaggg cttttgctcg gcatcaaggc tgccgttccc      1020
     tcagccgaac tgctgcaggc gatccgcgcc gcccatctgc tcggcgtgcc tgccggcgac      1080
     aatgtcatcc gccttcttcc gccgctcgtg gtcaccgccg aggaagcccg cgagggcctt      1140
     tcccgcgtcg agcgcgccgc cgagagcatt cgcgcctcca aggtcaagaa gacggcttga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page