(data stored in ACNUC7421 zone)

EMBL: CP001622.PE185

CP001622.PE185       Location/Qualifiers
FT   CDS_pept        185530..186444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0186"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: ret:RHE_CH00517 ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54497"
FT                   /db_xref="GOA:C6AZH1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH1"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACS54497.1"
FT                   /translation="MSPKHFLDLSAVTSADLRTIMNDALARKQAFKAGQGDKPLAGKML
FT                   AMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIR
FT                   TTEHSRLVELAQHATVPVINALTDDTHPCQIMADIMTFEEHRGPIKGKTIAWTGDGNNV
FT                   LHSLVEGAARFGYRMNMAVPLGSEPKDHYLNWARNEGAEIMLCHDADRAVAGVDCVVTD
FT                   TWVSMNQEHRARGHNVFQPYQVNAALMAKAGNDALFMHCLPAHRGEEVTDEVIDGPQSV
FT                   VFDEAENRLHAQKSILAWCLGAI"
     atgagcccta aacacttcct cgatctttcg gcggtcacat cagccgatct cagaacgatc        60
     atgaacgatg cgctcgcccg caagcaggcc ttcaaggcgg gccagggcga caagccgctc       120
     gccggcaaga tgctggcgat gatcttcgag aagccgtcga cgcgcacccg cgtctccttc       180
     gacgtcggca tgcgccagct cggcggcgaa acgctgttcc tgtccggcac cgagatgcag       240
     ctcggccgcg ccgagacgat cggcgacacc gccaaggtgc tgtcgcgtta tgtcgatgcg       300
     atcatgatcc gcaccaccga gcattcgcgg ctggtcgagc tggcccagca tgcgaccgtg       360
     cctgtcatca atgcgctgac ggatgacacc catccctgcc agattatggc cgatatcatg       420
     accttcgaag agcaccgcgg cccgatcaag ggcaagacca tcgcctggac cggcgacggc       480
     aacaatgtgc tgcattcgct ggtcgagggt gccgcccgct tcggctaccg catgaacatg       540
     gccgtgcccc ttggctcgga gcccaaggat cactatctga actgggcccg caatgagggc       600
     gccgaaatca tgctttgcca tgatgccgac cgtgcggtcg ccggcgtcga ttgcgtggtg       660
     accgatacct gggtctccat gaatcaggaa catcgggccc ggggtcacaa tgtcttccag       720
     ccttatcagg tcaacgcggc cttgatggcg aaagccggca atgatgcatt gttcatgcat       780
     tgcctgcccg ctcatcgcgg tgaggaagtg acggacgaag tgatcgacgg tccgcaatcc       840
     gtggtcttcg atgaggcgga aaaccgtctt catgcgcaga agtcgattct tgcttggtgc       900
     ctgggcgcga tctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page