(data stored in ACNUC7421 zone)

EMBL: CP001622.PE186

CP001622.PE186       Location/Qualifiers
FT   CDS_pept        186535..187527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0187"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: rec:RHECIAT_CH0000593 33K
FT                   chaperonin (heat shock protein 33) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54498"
FT                   /db_xref="GOA:C6AZH2"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH2"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACS54498.1"
FT                   /translation="MAEAAAALGQFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHHYPAPVARLLAEVVVLTVLLGTSLKFDGKFTVQTKGDGPVDLLVADFSTPENVRAYA
FT                   RFDQALLNKAIESGETEPEQLLGKGVLAFTIDQGKFSQPYQGIVPLDGTTLEDIAGVYF
FT                   RQSEQIPTRVRLAAAELFDRDDAGKPRHRWRAGGLVAQFLPEAPERMRQPDLHGGDGDT
FT                   GSRPHGEDDAWLEARSLVETIDADELTDPLVGTERLLFRLFHERGVRVYEPRAVFDRCS
FT                   CSRDKIKGVLKGFSAEEIEASQEDGEIAVTCEFCSTTYRFEPAELQPAE"
     atggcagaag ctgcagccgc cctcggccag tttgatttcg ccggcgatga ccatgtcgtc        60
     cccttccagg tggaagggct ggatgtgcgc ggccgcgccg tccagctcgg cccgatgctc       120
     gacgccatcc tcgagcgtca tcattatccc gcacccgttg cccggctgct tgccgaagtc       180
     gtcgtgctga cggtgctgct cggcacctcg ctgaagttcg acggcaagtt cacggtgcag       240
     accaagggcg acggcccggt cgatcttctc gtcgccgatt tctcgacgcc ggaaaatgtc       300
     cgcgcctacg cccgtttcga tcaggcgctg ctcaacaagg cgatcgagtc aggtgaaacc       360
     gagccggagc aactgctcgg caagggcgtg ctcgccttca ccattgacca gggcaagttc       420
     agccagccct accagggcat cgttccgctc gacggcacca cgctggaaga tattgccggc       480
     gtctatttcc gccagtcgga gcagatcccg acgcgcgtcc gtcttgccgc ggccgaactc       540
     ttcgaccgtg acgatgcggg caagccgcgc catcgctggc gggcaggcgg cctcgtcgcc       600
     cagttccttc cggaagcgcc ggagcgcatg cgccagccgg atctccacgg cggcgacggc       660
     gacaccggca gccgcccgca cggcgaggac gatgcctggc tcgaagcgcg ttcgctggtc       720
     gagaccatcg acgccgatga actcaccgat ccgctggtcg gaaccgagcg gctgctgttc       780
     cgcctgttcc acgagcgcgg cgtgcgcgtc tacgaaccgc gcgcggtttt cgaccgctgc       840
     agctgctcgc gcgacaagat caagggcgtg ctgaagggct tttcggccga ggagatcgag       900
     gccagccagg aagatggcga aatcgccgtg acctgcgaat tctgctcgac cacctaccgc       960
     ttcgagccgg ccgaacttca gccggcggaa tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page