(data stored in ACNUC7421 zone)

EMBL: CP001622.PE187

CP001622.PE187       Location/Qualifiers
FT   CDS_pept        187660..188247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54499"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000594"
FT                   /protein_id="ACS54499.1"
FT                   /translation="MRLLFFVLALIAAMPPVSLADDQTVPWKEVGGWSVAVDPTLDNGC
FT                   FVLTSFDDDTIFRLGFNFRKKDNPLYILLGNPNWKSLEKGKHYPIELSFDQSKRTADGR
FT                   GLDLDGLKSLWIDFEDPDLIEEFAGKLSFRASFGGKQIVALGLKDSASAADELLACQKA
FT                   VNDAVAKHPAPPQSKDPFEAKPGTQASDPFDL"
     atgagacttt tgttttttgt actcgcgctc atagctgcga tgccaccagt gagcttggct        60
     gatgaccaga cagtcccatg gaaagaggtc gggggctgga gcgtggctgt cgacccgact       120
     ttagacaatg gctgttttgt tctgacttcc tttgatgacg acaccatttt tcgtcttggc       180
     ttcaatttcc gcaaaaagga caaccctctt tacattctgc tcggaaaccc aaactggaaa       240
     tccttggaga aaggtaagca ttatcccatc gaactctcgt tcgaccagtc taaacggacg       300
     gctgatggga gaggtctgga tctcgatggc ctcaaatcat tatggattga tttcgaggat       360
     cccgacttga ttgaggagtt cgctggtaaa ctgagtttcc gcgccagctt tggaggaaag       420
     cagattgtgg ctctcggttt gaaagattcc gccagtgcag cggatgagtt gctcgcctgc       480
     caaaaggcgg taaacgatgc ggtcgcaaaa catccggcgc cgccacaatc aaaagatccg       540
     ttcgaagcaa agccaggcac ccaggcctcg gatccttttg acctttag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page