(data stored in ACNUC7421 zone)

EMBL: CP001622.PE188

CP001622.PE188       Location/Qualifiers
FT   CDS_pept        complement(188383..188775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0189"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ret:RHE_CH00521
FT                   ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54500"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH4"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACS54500.1"
FT                   /translation="MYRALTREIEVVVEPFYLEEQSDPDDDRYVWGYRIVISNNSGIAV
FT                   RLVNRYWNITDQNGQVDEVTGPGVVGEQPRLSPGDTYEYSSGCPLDTPSGLMFGHYQME
FT                   TDDGEMFDVDIPAFSLDSPGLLRVLN"
     atgtatcgcg ccctcacaag agagatcgaa gttgtcgtcg agccgttcta tctggaggag        60
     caatccgatc cggacgacga ccgctatgtc tggggttacc ggattgtcat cagcaacaat       120
     tccggcatag ccgttcgact ggtcaatcgt tactggaaca tcaccgacca gaacggccag       180
     gtggacgagg tgaccggtcc cggcgtcgtc ggcgagcagc cgcggctcag ccccggcgac       240
     acctacgaat attcctccgg ctgtccgctc gacacgccct cagggctgat gttcggccat       300
     taccagatgg aaacggacga cggcgagatg ttcgatgtcg acatccccgc cttctcgctg       360
     gattcacctg ggctgctgcg cgtgcttaat tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page