(data stored in ACNUC7421 zone)

EMBL: CP001622.PE189

CP001622.PE189       Location/Qualifiers
FT   CDS_pept        complement(189146..190330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0190"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="KEGG: ret:RHE_CH00522 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54501"
FT                   /db_xref="GOA:C6AZH5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH5"
FT                   /inference="protein motif:TFAM:TIGR01325"
FT                   /protein_id="ACS54501.1"
FT                   /translation="MSKTWRPATQLVHGGTLRSQYGETSEAIYLTQGFVYETSEAAEAR
FT                   FKGETEGFIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVTAAILCQLKSGDHIV
FT                   AARALFGSCRWVVETLAPKYGIDCTLIDGRDLANWEKAITPKTKVFFLESPTNPTLEVI
FT                   DIAGVAKLANQVGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLS
FT                   DKEWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVRQQTENAAKIADFLAEQGKV
FT                   AKVIYPGRKDHPQADIIAKQMTGGSTLVAFELKGGKDAAFALQNALDIVKISNNLGDSK
FT                   SLITHPATTTHKNLTDEARAELGISPGTVRLSAGIEDTDDLIEDFAKALDKVLA"
     atgagcaaga cctggcgccc ggcaacccaa ctcgtccacg gtggcacgct gcgttcgcaa        60
     tatggcgaga cgtccgaggc aatctatctc acccaaggct tcgtctacga aacgtccgag       120
     gcggccgaag cccgcttcaa gggcgagacg gagggcttca tctacgcccg ctacggcagc       180
     cccaccaacg acatgttcga aaagcgcatg tgcatgctcg aaggcgccga agacgcccgc       240
     gccaccgctt ccggcatggc cgccgtcacc gcggcgatcc tctgccagct gaaatcaggc       300
     gatcatatcg tcgccgcgcg cgccctgttc ggttcctgcc gctgggtcgt cgagacgctg       360
     gcgccgaaat acggcatcga ctgcacgctg atcgacggcc gggatctggc gaactgggaa       420
     aaggcgatca cgccgaagac caaggtgttc ttcctggaaa gcccgaccaa cccgacgctc       480
     gaagtgatcg atatcgctgg cgtcgccaag ctcgccaacc aggtcggcgc caaggtcgtc       540
     gtcgacaatg tctttgccac gccacttttc cagaagcccc tggagctcgg cgcccatatc       600
     gtcgtttatt ccgccaccaa gcatattgac ggccagggcc gctgcctcgg cggtgtcgtt       660
     ctttccgaca aggaatggat cgacgagaac ctgcacgact acttccgcca tactgggccg       720
     gccatgtcgc cgttcaatgc ctggacactg ttgaaaggca tcgagacgct gccgctgcgc       780
     gtgcgccagc agaccgagaa tgcggcaaag atcgccgatt tcctggccga gcagggcaag       840
     gtcgccaagg tgatctatcc cggccgcaag gaccatccgc aggccgatat catcgccaag       900
     cagatgaccg gcggctcgac gctggtcgcc ttcgagctga agggcggcaa ggatgcggcc       960
     tttgcgctgc agaacgcgct cgatatcgtc aagatctcca acaatctcgg cgacagcaag      1020
     agcctgatca cccatccggc gacgacgacg cacaagaacc tgacggatga ggcgcgcgcc      1080
     gaactcggca tttccccggg cacggtccgc ctttcggccg gcatcgagga taccgacgac      1140
     ctgatcgaag atttcgccaa ggcgcttgac aaggtcttgg cctga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page