(data stored in ACNUC7421 zone)

EMBL: CP001622.PE19

CP001622.PE19        Location/Qualifiers
FT   CDS_pept        complement(17871..18377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msl:Msil_1919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54331"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA7"
FT                   /inference="similar to AA sequence:KEGG:Msil_1919"
FT                   /protein_id="ACS54331.1"
FT                   /translation="MTDSNGISVVRTPVWIEHIRIVSKRSFDQVKTKIEKLPHFDNGIR
FT                   KILRDGDFVRVKKELERLQGSAGLIIFSVATHGDWLAIRGGSRHALQYVIGNVLISSEM
FT                   TKHQLPAGLYAPLRIMLYENEEGTATLEYDRPSDLFGQFNDDRVTSVAEHLDQQIYDCL
FT                   VAAAA"
     atgaccgaca gcaacggaat aagcgtggtt cgcaccccgg tctggatcga gcatattcgc        60
     atcgtatcca aaagatcatt cgaccaggtc aagacgaaga tcgaaaagct gcctcacttt       120
     gacaatggga tccggaaaat acttcgggat ggcgacttcg tcagggtcaa gaaggagttg       180
     gaaagattac agggcagcgc cgggctgatc atattttccg tggcaacgca cggggactgg       240
     ctggcgattc gtggcggaag ccgccacgcg cttcaatacg ttatcggcaa tgtgctgatt       300
     tctagcgaaa tgacgaagca ccagctgcca gcaggattgt acgcgccatt gaggatcatg       360
     ctctatgaaa atgaagaagg gactgcgacc ttggaatacg atcgaccgtc ggatctattt       420
     gggcagttca acgatgatag agtgacaagc gtcgcggagc atctcgatca acaaatctat       480
     gattgcctgg ttgcggcagc ggcctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page