(data stored in ACNUC7421 zone)

EMBL: CP001622.PE190

CP001622.PE190       Location/Qualifiers
FT   CDS_pept        190525..191619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0191"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /note="PFAM: 2-deoxycytidine 5-triphosphate deaminase;
FT                   KEGG: rec:RHECIAT_CH0000597 deoxycytidine triphosphate
FT                   deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54502"
FT                   /db_xref="GOA:C6AZH6"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH6"
FT                   /inference="protein motif:PFAM:PF06559"
FT                   /protein_id="ACS54502.1"
FT                   /translation="MMARETGILADRAISALFETGRLISERELDRDQIQPASLDLRLGG
FT                   KAFRVRASFMPGPSHLVSDKLDRLSLHVIDLSEGAVLETGCVYIVPLMESLALPAEMSA
FT                   SANPKSSTGRLDIFTRVITDYAQEFDKIPSGYSGPLYLEISPRTFPIVVRRGSRLSQIR
FT                   FRVGQALLGEPELLKLHESETLVASKLPNVSGGGIALSIDLAGDKDGLIGYRGKHHTAV
FT                   VDVDKKAEHDLFDFWEPLHSRGRNELILDPDEFYILVSREAVHVPPDYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMQEKPA
FT                   SLYGSGLGSNYQAQGLKLSKHFRI"
     atgatggctc gcgaaacggg aattctggcg gatcgcgcga tctccgcgct gttcgaaacg        60
     gggcgtctga tctccgagcg ggagctggac cgcgaccaga tccagccggc aagcctcgac       120
     ctgcgcttgg gcggcaaggc ttttcgggtg cgtgccagct tcatgccagg cccctcgcat       180
     ctggtgtccg acaagcttga ccggctgagc ctgcacgtga tcgacctctc cgaaggcgcg       240
     gtgctcgaaa cgggctgcgt ctatatcgtg ccgctgatgg agagcctggc gctgccggcc       300
     gagatgtcgg cctcggccaa tccgaagagc tcgaccgggc gcctcgatat cttcacccgc       360
     gtcattaccg actacgccca ggaattcgac aagatcccat caggctattc cggcccgctc       420
     tatctcgaaa tcagcccgcg caccttcccg atcgttgtgc gccgcggctc gcggctgtcg       480
     cagatccggt tccgcgtcgg ccaggcgctg ctcggcgagc cggaactgtt gaagctgcat       540
     gagagcgaga cgctggtcgc cagcaagctg ccgaacgttt ccggcggcgg catcgccctg       600
     tcgatcgacc tcgccggaga caaggacggc ctgatcggtt atcgcggcaa acatcacacc       660
     gccgtcgtcg acgtcgacaa gaaggccgag cacgacctct tcgatttctg ggagccgctc       720
     cacagccgcg gccgcaacga gctgatcctc gatcccgatg aattctatat cctcgtctcg       780
     cgcgaggcgg tgcacgtgcc gccggattac gcagccgaaa tgaccccctt cgatccgctg       840
     gtcggcgaat tccgcgtcca ttatgccggc ttcttcgatc cgggcttcgg ccatgcgcct       900
     gccggcgggc gcggcagccg cgcggtgctc gaagtgcgca gccacgaggt gcccttcatc       960
     ctcgaagacg gccagatcgt cggccgcctc gtctacgaac acatgcagga aaagcccgcc      1020
     agcctctacg gctccggcct aggctccaat taccaggccc agggcctgaa gctctcgaag      1080
     cacttccgca tctga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page