(data stored in ACNUC7421 zone)

EMBL: CP001622.PE191

CP001622.PE191       Location/Qualifiers
FT   CDS_pept        191883..193268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0192"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: oan:Oant_2329
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54503"
FT                   /db_xref="GOA:C6B084"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6B084"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS54503.1"
FT                   /translation="MAKVVGLADFDRHLTKRNGFYSYKRRVPAAIGNLDPRYPTVRVAL
FT                   GTREVGEARAKRDAHERADDLLWASLTEGGDQVAAEARYKSAVARAKALGYTYRHLPAI
FT                   LSEESGESILSRLRAVQDVKPASPQETAILGGVPRPQVSVWRALEIYIEEIVADEISGK
FT                   SPAQRELWENTKRRAVTSFVEVCGELNIDEITREHARQFYNRWREKIAPNPKSGQHATH
FT                   TPSSGNREVGNMRVLYQKYFEYMGVEDITNPFRNLSFSEKKVGQKKKKKRLPFTAEWIE
FT                   KHILKPGALARLNDQARAISLVLAETGCRPSEVANLVESQIFLDHPVPHIAIESRLDPE
FT                   DPREIKTDASVRVIPLVGVALEALKKFPKGFPRYRDKESSMSATLNKYFRENGLFPTEK
FT                   HVIYSFRHGFEDRMTVAGLDTELRMMLMGHTNSRPEYGEGGTLEWKQAQLAKIALPFDL
FT                   AIV"
     atggcgaagg ttgttggttt ggccgatttc gatcggcatc ttacgaaaag aaacggcttt        60
     tactcctaca aacggcgcgt gccggcggcc atcggtaacc ttgatccgcg atatccgacc       120
     gtccgggttg cccttggaac gagggaggta ggagaagcgc gcgcgaagcg agatgcgcac       180
     gagcgggcgg acgacctctt gtgggcgtcg ttgaccgaag ggggcgacca agttgcggcc       240
     gaggctcgtt ataaatcggc cgtggcgcgt gccaaggcgc tgggctacac ttatcgtcat       300
     ctgcccgcga tcctatcgga ggagagtggc gaaagcatcc tctcccgttt gcgcgctgtg       360
     caggacgtca agccggcctc gccgcaggaa accgccattc taggaggtgt gccgcggccg       420
     caggtttccg tctggcgggc attggaaatc tatattgaag agatcgtggc ggacgagatt       480
     tccggcaaga gtccggccca gagagaacta tgggagaata ctaaacggcg ggctgtcaca       540
     tcgttcgttg aggtgtgcgg tgaactaaac atcgacgaaa tcacgcgcga acatgcccga       600
     caattctaca acagatggcg ggagaagatc gctcccaacc cgaaatccgg ccaacatgca       660
     acccacactc catcctcggg aaaccgagaa gtcggaaata tgcgtgtgct ttaccaaaag       720
     tatttcgaat acatgggcgt ggaagacatc actaatccat tccgcaatct gtcgttctca       780
     gaaaagaagg taggccaaaa gaagaaaaag aaacggctgc catttacggc cgagtggatc       840
     gagaagcaca ttctaaaacc cggtgccctg gcccggctca atgaccaggc gcgggcgatc       900
     tctcttgttc tcgccgaaac cggttgccgc ccctcggagg tagcaaactt ggtcgaaagc       960
     caaatattcc tcgaccaccc agtgccgcat attgctatcg agtcgcggtt agatccggaa      1020
     gatccgaggg aaatcaaaac cgacgcgtcg gtgcgtgtaa tacctttggt aggcgtcgcc      1080
     ctagaggctc tgaagaagtt tccaaaaggg tttccgcgat atcgcgacaa ggaaagcagc      1140
     atgtccgcga ctttgaacaa gtacttcaga gagaatggcc tgtttccgac ggagaagcac      1200
     gtcatctaca gcttccgtca cggctttgag gatcggatga cagtggccgg actagatacc      1260
     gaactgcgca tgatgctgat gggccacacg aattcgcgac cagaatacgg cgaaggcgga      1320
     acgctagagt ggaagcaggc acaactcgct aagatcgcgc tcccgttcga cctggcaatc      1380
     gtctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page