(data stored in ACNUC7421 zone)

EMBL: CP001622.PE193

CP001622.PE193       Location/Qualifiers
FT   CDS_pept        194836..196695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0194"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; peptidase
FT                   M41; SMART: AAA ATPase; KEGG: rec:RHECIAT_CH0003340
FT                   putative ATP-dependent hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54505"
FT                   /db_xref="GOA:C6B086"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C6B086"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACS54505.1"
FT                   /translation="MYHHLDRRVFAETSSNTAKFLMLCALRQALRGTDQFKVDAKGIIV
FT                   CIVDKAWLWYAKSAANVLMTGGKVHSYYDDFRRPVHIIGESPRRTTSKGVEDSTVFRPE
FT                   HQVIYLASSLDAVRLSLQLAADVIVNILPPTARHVIAARKVLGVEDVDMPLAEAIAQQS
FT                   AEIVIGLTARNSLKGLDIATLTKPIAVPERSHKLSELPGYGPARPWVDAIKQDVADWRE
FT                   GKLPWTDVDRGILLLGAPGTGKTLFATALANELGFDLVLTSVGAWQGSNNGYLGDMLAA
FT                   MSKSFADATARRGAVLLVDELDAIGDRATMRGDHAFYEGNVIGRFLELTTHALEQPGTI
FT                   IVGATNYGHLIDNAVLRSGRLEKHVYLELPEDEERAEILAYHFNQALPAKDLREITDKL
FT                   RLVTPADLEKLARAAKRAARIRKGLLSIQDVKAILPAQVPLPEAVVHRICVHEIGHALM
FT                   AMASGSADVISIRVESHMVEGQFVQDGGRLHYKIHNEALPSDKDLLAKIRIMLGGTAAE
FT                   EVVFGNRSIGAGGVEGSDLDQATRLAYRLVGSYGLGKWLRYQMGANRVDETFVPAPELR
FT                   AEVDGILAREYRATKELLSKEKAHLMRLAAELVVDRKLLIDKK"
     atgtatcatc acctcgatag gcgggtcttt gcggaaacca gcagcaacac ggcaaagttc        60
     ttgatgcttt gcgctcttcg ccaggccctt cgcggaacgg atcagttcaa ggtcgatgcg       120
     aaaggcatca tcgtctgcat cgtcgacaag gcttggctct ggtatgcgaa gtccgcggcg       180
     aatgtcctta tgacgggcgg caaagtgcat tcgtactacg acgacttccg tcgcccagtg       240
     catatcatcg gtgagtcgcc ccggcgtacg acgtcgaagg gcgtcgaaga ttccacagtc       300
     tttcgtccgg agcaccaggt catctatctt gcgtcgtctt tagacgccgt gaggctttcg       360
     ctgcagttag ctgctgacgt gattgtcaac atcttgccgc ccacggcgag acacgtgatc       420
     gcggcgcgta aggtgctcgg cgtcgaagac gttgacatgc cgcttgcaga agcgatcgcg       480
     cagcagtcgg cggagatcgt catcgggctt accgcaagga actcgctcaa gggcctcgac       540
     atagcgacgt tgacgaagcc gatcgcggta cctgagcgtt cgcacaagct gtcggaactg       600
     cctggatacg gtccagcacg tccttgggtc gatgccatca agcaggacgt cgccgattgg       660
     cgggagggta aacttccctg gacggatgtg gacagaggaa tccttctcct gggcgcgccc       720
     ggaaccggca agacgctttt cgccacggca ctcgccaacg agctcggatt cgatctggtc       780
     ttgacgtcgg tgggcgcatg gcagggatcc aataacggct accttggcga catgcttgcc       840
     gcgatgtcca agtccttcgc cgacgccacg gcgcggcgcg gagctgtgtt gctcgtggac       900
     gaactcgatg ccatcggaga tcgcgccacg atgcggggag atcatgcctt ctacgaaggc       960
     aacgtcatcg gcagatttct tgaactgacg acgcatgcgc tcgaacagcc cggcacaatc      1020
     atcgtcggag ctacaaacta cggacacctc atcgacaacg ctgtcctgcg atccggacgc      1080
     ctcgagaaac acgtgtacct tgagttgccc gaggacgagg agcgcgcgga aatcctcgcc      1140
     tatcatttta atcaggccct acctgcgaag gacctgcgtg aaatcacgga caagctaagg      1200
     ctcgtcacac ccgccgacct ggaaaagctt gcgcgagcgg caaaacgagc ggcgaggatt      1260
     cgaaaggggc ttcttagtat ccaggacgtc aaagccattc ttccagcgca ggttccgctt      1320
     cccgaagccg tcgttcaccg catctgtgtg catgagatcg gtcacgcact tatggcgatg      1380
     gcatcggggt cagcagatgt gatcagcatc agagtcgaat cccatatggt ggagggccag      1440
     ttcgtgcagg acggcggtcg gctgcattac aaaatacaca atgaagcgct tccgtcggac      1500
     aaggatttgc tcgccaagat caggatcatg ctgggcggga ccgcggctga ggaagttgtg      1560
     ttcggcaaca gatccatagg cgctggcggc gtcgaaggga gcgatctgga ccaggctacc      1620
     cggctcgctt accggctggt tggcagctat ggcctgggga aatggcttcg ttaccagatg      1680
     ggtgcaaatc gcgtggacga aacctttgta ccggcgccag agcttcgagc cgaagtcgat      1740
     gggatccttg cgcgggaata tcgggcgacg aaggagttgc tcagcaagga aaaggctcat      1800
     ctcatgcggc tcgccgccga actcgttgtc gatcgaaaat tgctgatcga caaaaaatga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page