(data stored in ACNUC7421 zone)

EMBL: CP001622.PE194

CP001622.PE194       Location/Qualifiers
FT   CDS_pept        196763..197059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54506"
FT                   /db_xref="UniProtKB/TrEMBL:C6B087"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54506.1"
FT                   /translation="MESGARVEFTVYCHEIISASDVGLHFAATLAKSKAEVGEYRKALR
FT                   TINPTGEPLGTLAIYEMVLRMPDVATMVDLLNSPESLLRTCLMSRKLVALTAD"
     gtggaaagcg gggctcgcgt ggaattcacc gtctattgcc acgaaatcat ctcggcgtcg        60
     gatgtaggcc tccacttcgc tgcgacactc gcaaagtcga aagcggaagt gggtgaatat       120
     cgcaaggctc tccgaacgat caatccgaca ggcgaaccgc tgggcacttt ggctatttat       180
     gagatggttc tgcggatgcc cgacgtggcg acgatggtcg accttctcaa ctccccagaa       240
     tccctcctta ggacttgctt gatgagcagg aagcttgtgg cgctgacggc cgattaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page