(data stored in ACNUC7421 zone)

EMBL: CP001622.PE195

CP001622.PE195       Location/Qualifiers
FT   CDS_pept        197189..199153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54507"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C6B088"
FT                   /inference="similar to AA sequence:KEGG:BBta_3314"
FT                   /protein_id="ACS54507.1"
FT                   /translation="MRLKSFSVSEFRSIIASGEITLGDVTCLVGKNEAGKTALLKALYK
FT                   LSPMSTTDARFDVTDDYPRKDLGDYQHEVDEGVRGQAVPIRATFELTDAEVSSVANLFG
FT                   PKALTSNVLTLEKSYDNRRVYSLDFNETEALKYVVSSAELESADLAAVGDVQTWKGLGN
FT                   RLAELAASPTGAKLKMLVDKINDKGSGGGYYAYNSILSRSVPEFLYFDEYYQMVGHDNV
FT                   EALIQRRDSEDLRPSDHPLLGLINLARLSLDDLISSKRTMEMVNKLEAAGNHLTRQILK
FT                   YWSQNKHLQMKFDVREAMADDPVEMRSGHNIWGRVYDQVHWATTELSSRSRGFVWFFSF
FT                   LAWYEDVKRARKNIILLLDEPGTSLHGRAQGDLLRYIEQELRPHHQVIYTTHSPFMVDP
FT                   QHFDRVRIVQDRGIDSDDPLPREEDGTKVLENVFDASDDSLFPLQGALGYDISQTLFIG
FT                   PNSLVVEGPSDLFYLRGMSSLLEREKRTGLSPEWTLTPVGGSSKIPTFVAMLAPQRGMN
FT                   VAVLVDIQASDRQTVEGLYKKKLLDQKNVHTFADFTGLVESDVEDMFERDFYVNLVNEE
FT                   FRGQLSSKITASKLNRNLPRVLRALEEHFQTSPLKSGQFGHYRPARYFAENLAVLTPKI
FT                   SEETKNRFEALFKKLNAQL"
     atgaggctga agagttttag cgtgtcggag tttcgcagca tcattgcttc tggcgagatc        60
     acgcttggag acgtaacatg ccttgtcggt aagaacgaag cgggaaagac ggctctcctg       120
     aaggcccttt acaagctatc gccgatgtcc actaccgatg ccagattcga cgtgacggat       180
     gactacccgc gcaaggatct gggcgattac cagcacgaag tcgacgaggg tgtcaggggt       240
     caagccgtcc ctatacgtgc gacgttcgaa ttgaccgacg cggaggtttc atccgtagca       300
     aacctgttcg ggcctaaggc tctgacttca aacgttctta cgttggagaa atcatacgac       360
     aatagacggg tctactcact ggactttaac gagacggagg ccctgaagta cgtcgtttcg       420
     tccgccgagc tggaaagtgc cgatcttgcg gctgtcggcg acgtccagac atggaagggc       480
     ttggggaacc gactggcgga gctggccgca tcgcccaccg gagcgaagct aaaaatgctc       540
     gttgataaga tcaacgacaa gggttccgga ggtggctact atgcgtacaa ttctatcttg       600
     agcaggagcg ttccggagtt cctctacttc gacgaatatt accaaatggt tggtcacgat       660
     aacgttgagg ccctcatcca acggcgcgac agcgaagact tacggccgtc ggaccacccg       720
     cttctaggct tgatcaatct tgcccggctc agcctcgacg acttgatctc gtccaaaagg       780
     acgatggaga tggtcaacaa gctggaggca gcaggaaacc atttgacccg ccagatcctc       840
     aaatactggt cacaaaacaa gcatcttcag atgaagttcg atgtccgcga ggcgatggcc       900
     gacgacccgg tcgaaatgag gagcgggcat aacatctggg gccgcgtcta cgaccaggtg       960
     cattgggcga ccacggagct gagctcccga tcacgaggct tcgtctggtt cttctcgttc      1020
     ctcgcttggt acgaagatgt gaaacgagct cgcaagaaca ttatcctcct tctcgacgag      1080
     ccgggcacct cgctacacgg tcgcgcacag ggcgatcttc tacggtatat cgaacaggag      1140
     ctgcgtccgc accatcaggt aatctacacc acgcactcgc cgttcatggt ggatcctcag      1200
     cacttcgacc gagtcaggat cgtgcaggac aggggcatcg attctgacga tccattaccg      1260
     cgggaagagg acggaacgaa agtcctggaa aacgtgttcg acgcctccga cgacagtctc      1320
     ttcccgttgc agggtgcact cggctacgac atcagccaga cacttttcat cggacccaac      1380
     tctctcgtcg tggaaggacc atcggacctc ttttaccttc ggggtatgag cagtctcctc      1440
     gaaagagaaa agcgaaccgg gttgagtccg gaatggacgc ttacgcccgt cggcggaagc      1500
     agcaaaatcc ctactttcgt ggccatgctg gctccacaaa ggggcatgaa cgtcgcggtt      1560
     ctcgtcgata tccaggctag cgaccggcag actgtggaag ggctttataa gaagaagctg      1620
     ctcgaccaga aaaacgtcca tacgtttgcc gatttcactg gccttgtaga atccgacgta      1680
     gaggacatgt tcgagcgcga cttctacgtc aatctagtca acgaggagtt ccgcgggcag      1740
     ctatcgtcga agataacggc ttctaaactc aaccggaacc tacctcgcgt actgcgcgcc      1800
     cttgaggagc attttcaaac gtcgcctctg aaatcggggc agttcggaca ttacagacct      1860
     gcacgctact tcgctgaaaa ccttgctgtt ctcacgccca aaatctccga ggaaacgaag      1920
     aaccgcttcg aggcattgtt caagaaactg aatgctcaat tatga                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page