(data stored in ACNUC7421 zone)

EMBL: CP001622.PE197

CP001622.PE197       Location/Qualifiers
FT   CDS_pept        complement(199729..202566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54509"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:C6B090"
FT                   /inference="similar to AA sequence:KEGG:SMc02155"
FT                   /protein_id="ACS54509.1"
FT                   /translation="MKPWREVAVPHRDVLEGTFQQSEFAADITAVNTGKASREYQDAGA
FT                   FFDRTFITEGMALLLTQVAQRLTGRGGEPVVQLQTAFGGGKTHTMLAVYHLATRKCALS
FT                   DLAGISALVDRAGLMDVPQARVAVLDGVAHAPGQPWKRGSQTIKTLWGEMAWQLGGAEA
FT                   FALLAEADVTGTSPGKDVLRDLLERHSPCVVLIDELVAYIRQFPESQPISGGSYDSNLS
FT                   FVQALTEAAKLVPRAIVLASLPESDLEAGSQRGAAALRALEKTFGRVQALWKPVATEEA
FT                   FEIVRRRLFEPVRDEKTREGVCRAFADAYIAEGVKLPADTQERHYYDRLLHAYPIHPEV
FT                   FDRLFEDWTTIDGFQRTRGVLKLMAKVIFRLWKDDNKDLLIMPGSLPLYDGSSRNELTY
FT                   YLPAGWDAVIERDIDGDRAETTALENKEPRFGQVGAARRIARTVFLGSAPSSVASKVVA
FT                   RGIDRAHIILGCLQPGQAASVYADALGRLADRLHYLNSSGDKSHDATRFWFDTRANLRR
FT                   EMEDRKRRFDDRTEVRGKIAGALKQTVGSLTYFDGVHIFAPHGDVPDDTALRLLVLPPE
FT                   TWYARDENRLAFEAVLETIGKNGPKPRYRSNRLLFLAPDHAALSRLMDATRVALAWGSI
FT                   VEDVKEGRLNIDLLQKNQAEKELKSAEDALPRVVRECYKWLLCPMQDAATDPKPGIEAF
FT                   ALNTAGGSIAADIERVCIDNELVITTWSPIHLRTKLKELYWKGGKRAANAAGFFEDTLR
FT                   YLYMPRLKTRDVLSQAIQAGVAGKDFFGTAYGEADGKFEGFYFGGGTVIFDDTLLLIEP
FT                   QAAQAYEEANREAQPAATPPVSTATAAGGVAEAPNVYVFNGGSTSPPVAITPTSGPTKP
FT                   KTFYGSAEVPPATAKMRLVQIAEEIVSVLTSDPNATVRLVVEISAEFPDGAGDGLKRAV
FT                   SENARSLGLKSADWD"
     atgaaacctt ggagagaagt ggctgtaccc catcgggacg tgcttgaagg cactttccaa        60
     cagtcagagt tcgccgccga catcacagcg gtcaacactg gcaaggccag ccgcgagtat       120
     caggatgccg gcgcgttttt cgaccgcacc tttatcaccg agggcatggc gcttctatta       180
     acgcaggttg cgcagcgcct cacaggacgg ggcggtgagc cggtcgtgca gcttcagacc       240
     gcctttggcg gcggcaagac gcacaccatg ttggccgtct atcaccttgc cacccgcaaa       300
     tgtgccctgt ccgacctggc tggtatctct gcgcttgtcg accgggccgg cttgatggat       360
     gtgccgcagg cccgcgtcgc agtgctggac ggcgttgcgc acgcgccggg ccagccatgg       420
     aagcgcggga gccagacaat caagaccctg tggggcgaga tggcgtggca gcttggcggg       480
     gcggaagcct tcgcgcttct cgccgaggct gacgtcactg gcacatcgcc cggcaaggac       540
     gtgctacgcg atcttctgga acgtcactct ccatgcgtag tgctgatcga tgagttggtg       600
     gcctatatcc gtcaattccc agaatcacag ccgatcagtg ggggtagcta cgattcgaac       660
     ctctccttcg tgcaggctct caccgaagcc gcgaagctgg tgccgcgtgc catcgtgctc       720
     gcatcgttgc cggaatccga tcttgaagcg gggagtcagc gcggcgccgc ggctctgcga       780
     gcactcgaaa agacctttgg gcgtgtacaa gcgctttgga agccagtggc gaccgaggaa       840
     gccttcgaga tcgtgcgccg ccggctattc gagccggtac gcgacgagaa gacccgcgaa       900
     ggcgtttgcc gcgccttcgc cgacgcctac atcgccgagg gtgtgaagct tcctgccgat       960
     acacaagaac gacactacta cgaccgactg ctgcacgctt atccgatcca ccctgaggtt      1020
     tttgatcgcc tctttgagga ctggacgacc attgacggtt ttcagcgcac gcggggcgtc      1080
     ctgaagctca tggcgaaggt catcttccgg ctgtggaagg acgacaacaa agacctgctc      1140
     atcatgcctg gtagcctgcc gctttatgat ggcagcagcc gcaacgagct gacctattat      1200
     ctgcccgcag gatgggacgc tgtgatcgag cgcgacatcg acggcgaccg cgccgagacg      1260
     accgcgcttg agaacaagga gccgcgcttc ggtcaagtgg gtgcggctcg gcgcattgcg      1320
     cgcacggtct tcctcggcag cgccccgtcg tcggtcgcgt ccaaggtcgt cgctcgcggc      1380
     attgaccgcg cccatatcat tctcggctgc cttcagccgg gacaggcggc gtccgtctat      1440
     gccgatgcgc tcggccggct ggccgaccgg ctgcactatc tcaattcctc gggcgacaag      1500
     agtcatgacg cgacgcgctt ctggttcgac acccgcgcaa atcttcggcg ggaaatggag      1560
     gatcggaagc gccggttcga cgaccgcacg gaggtgcgcg gcaagatcgc aggagcgttg      1620
     aaacagaccg ttggcagcct cacttatttc gacggcgtgc atatcttcgc gccgcatggc      1680
     gacgtgccgg atgacaccgc cctgcgcttg ctcgtgctgc cgccggaaac ttggtacgcc      1740
     cgcgacgaaa atcgcctcgc ctttgaagcg gtgctggaga caattggcaa aaacggcccc      1800
     aagccgcgat accgcagcaa ccgactcctt ttccttgcac cagatcatgc tgcgctttcc      1860
     cgtcttatgg acgcaacacg cgtcgcgctc gcatggggtt cgattgtcga ggacgtgaaa      1920
     gagggccgcc tgaacatcga cctcttgcag aaaaatcagg ccgagaaaga actgaagagt      1980
     gcagaggacg cgctgccgcg cgtggtccgc gaatgctaca aatggctact ctgcccgatg      2040
     caggatgcag caaccgatcc gaagcccgga attgaggcat tcgccctaaa tactgccggt      2100
     ggctcgatcg ccgcggacat cgagcgagtt tgcatcgaca acgaactggt tatcaccact      2160
     tggtcgccga tccacctgcg caccaagctt aaagagcttt actggaaggg cgggaagcga      2220
     gcggcaaacg cggccgggtt cttcgaggac accctgcgct atctctacat gccgcgcctc      2280
     aagacgcggg atgttctgtc gcaggcgatc caggctgggg tagcaggcaa ggactttttt      2340
     ggcaccgcct atggggaagc agatggcaag tttgagggct tttacttcgg cggtggcact      2400
     gtcatctttg atgacacatt gcttttgatc gagcctcaag cagctcaagc ctatgaggaa      2460
     gcaaaccggg aggcacaacc tgccgctact ccgcctgttt ccactgccac ggcggcaggc      2520
     ggcgtggccg aggcgccgaa tgtctatgtt ttcaatggcg ggagcacatc gccgccggtg      2580
     gcaatcacac ctacgtcagg ccctacgaag ccgaaaacct tttacggttc cgccgaggtt      2640
     ccgcccgcga ccgcaaagat gcgccttgtg cagatcgccg aggaaatcgt gtcggtgctc      2700
     acatccgatc caaatgcgac cgtccgcctt gtcgtggaaa tttcggccga gttcccagat      2760
     ggagcaggcg atggcttgaa acgtgcagtc tcggaaaacg cccgcagcct tggcctgaaa      2820
     tcggcggatt gggattaa                                                    2838
//

If you have problems or comments...

PBIL Back to PBIL home page