(data stored in ACNUC7421 zone)

EMBL: CP001622.PE198

CP001622.PE198       Location/Qualifiers
FT   CDS_pept        complement(202580..205489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0199"
FT                   /product="protein of unknown function DUF1156"
FT                   /note="PFAM: protein of unknown function DUF1156; KEGG:
FT                   sme:SMc02154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54510"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="UniProtKB/TrEMBL:C6B091"
FT                   /inference="protein motif:PFAM:PF06634"
FT                   /protein_id="ACS54510.1"
FT                   /translation="MTATVKTPKKLIEVALPLDAINEACAHEKQPGIGAHPRGLHLWWA
FT                   RRPLAAARAVIFAQMVNDPSWKWELERPGDIPPNNIKASWAASRNRLFAIIKEMVKWEN
FT                   STNEAVLQKARAEILRSWRETCDLNKDHPRAAQLFDPERLPAFHDPFAGGGALPLEAQR
FT                   LGLESYASDLNPVAVLINKAMIEIPTKFAGRPPVSPVARDSQDAWSRQWAGVRGLAEDV
FT                   RHYGQWIRDQAQKRIGNLYPPVEITADMARERPDVMPLVGQRLNVLTTIWARTVKSPNP
FT                   AFRHVNVPLVSTFILSSKAGKEAYVEPIVSGDTYRLTVKVGKAPKDSDEGTKFSRGNFR
FT                   CLLSQAPISADYIRSEAKAGRMGARLLAVIAEGRNGRIYLPPTSEQEDAANKAQPLWKP
FT                   ELEFFQQALGFRIGNYGMTAWSDLFTARQLVALTTFSDLVSDVIEVIRRDAISAGVDDD
FT                   GIPLNDGGNSALAYAQAVGVYLAFAISRLADYGSSIATWKPSGEQVMQTYKRQALPMTW
FT                   DFPDSNLLGDKAICWTNAVKYAADNLLSTAAASTQAEGFAIQSDAQQQTISQNKVVSTD
FT                   PPYYDNIGYADLSDFFYVWLRKTLKPVYPELFATVAVPKAEELVATPARHGGREGAEEF
FT                   FLHGMTQAMQRLATQAHPSFPVTIYYAFKQSETQNDTGTSSTGWETFLDAVIRSGLALT
FT                   GTWPMRTELGNRMRGQESNALASSIVLVCRPRSATADTISRRVFQRELNQVLPEALDEM
FT                   TRGSGEDRSPVAPVDLSQAIIGPGMAVFSKYAAVLEADGTPMTVQTALRLINRFLAEDD
FT                   FDHDSQFCLHWFEQYGWKEGRFGEADTLARAKGTSVDGVKQSGVLLAMGGIVRLLKWAE
FT                   YPAEWDPTNDARLPVWEALHHLIRVFKTDGESGAGKVLAAIAAKAEPTRQLAYRLYTLC
FT                   ERAGWAEDARAYNEIITSWGAIESGAAMAPKARQSDLFG"
     atgaccgcta ctgtcaaaac cccgaagaag ctgatcgagg tcgcgctgcc attggatgcg        60
     atcaacgaag catgcgcgca cgaaaagcag ccgggtatag gagcgcatcc acgagggttg       120
     catctttggt gggcacgacg cccgctggca gcagcgcgcg ccgtgatctt cgcgcaaatg       180
     gtcaacgacc cttcatggaa gtgggagctt gaacgccctg gcgacatacc gccgaacaac       240
     attaaggcaa gctgggcggc cagtcgcaac cgcctgttcg caatcatcaa agaaatggtc       300
     aaatgggaga actcgaccaa cgaggccgtc ctgcaaaaag cccgcgccga gattcttaga       360
     tcatggcgtg agacctgcga tctcaataag gaccatccac gagcggcgca actgttcgat       420
     cctgaaaggc tgcccgcctt tcatgacccc ttcgctggcg ggggagcatt acccctggaa       480
     gcgcagcgtc tcggtctgga atcctatgcg tccgacctca atccagtcgc cgtcctcatc       540
     aacaaggcga tgatcgagat tccaacgaaa tttgctggtc ggccgccggt tagcccggtt       600
     gcccgcgaca gtcaggatgc ttggagtaga caatgggcgg gtgtgcgggg cctcgctgag       660
     gacgtacgcc actacggaca gtggatacgg gatcaggcgc agaagcgtat cggcaaccta       720
     tatccgcctg tcgaaatcac agccgacatg gcaagagaac ggcctgatgt aatgccgctt       780
     gtcggacagc gacttaatgt tttgaccacg atttgggcgc ggacggtcaa aagccccaac       840
     ccagcctttc gccatgtaaa tgtgccgctg gtctcgacct tcatattgtc aagcaaggcg       900
     ggcaaagaag cctatgtgga acccattgtc agcggtgata cctaccgcct tacggtaaaa       960
     gtcggaaaag ccccaaagga ctcggacgaa gggacgaagt tttcgcgtgg caacttccga      1020
     tgcctactct cacaggcacc tattagtgct gattacatca gaagcgaggc caaggctgga      1080
     cgtatgggcg cccggctatt ggctgttatc gctgaaggcc gaaacggtcg catatacctc      1140
     cccccaactt ccgagcaaga agatgcggca aacaaggccc aaccattgtg gaagcctgaa      1200
     ctggagttct ttcagcaggc ccttggattc cgtatcggta actatggaat gacggcctgg      1260
     agtgatcttt tcactgcgcg ccaacttgtt gccctcacca cctttagcga tctcgtatcc      1320
     gatgtgatcg aagtgattag acgggatgcc atcagtgccg gcgtggatga cgatggaatt      1380
     ccgcttaacg atggcggcaa ttcagcctta gcctacgcgc aggctgtggg cgtctattta      1440
     gcgttcgcta taagtcgtct tgcagactac ggaagttcaa tcgctacctg gaagccatcc      1500
     ggcgagcagg tcatgcagac ctataagcgt caagctcttc caatgacgtg ggactttcct      1560
     gattcaaatc ttctcggaga taaggcgata tgttggacta atgcagtaaa atacgctgcg      1620
     gataatttat tgtctacggc tgcagcttca acccaagccg aaggatttgc gatccaaagc      1680
     gatgctcaac aacaaacaat aagccaaaat aaagtcgtat ctaccgatcc cccatactac      1740
     gacaatattg gatatgctga tctatcagat ttcttctatg tttggctgcg aaaaacactg      1800
     aagccagttt atccagaact ttttgcaact gtcgccgtcc ccaaagcgga ggagttggtc      1860
     gctacccccg ctcgccatgg cggcagggag ggggcggagg agttctttct ccacggtatg      1920
     acgcaggcca tgcaacgcct agcaactcag gcacacccgt catttccggt cacaatttac      1980
     tacgctttca agcagtccga gacgcaaaac gacacgggca cgtctagtac gggttgggaa      2040
     actttcttgg atgcggtgat ccgatccggg ctcgctctta ccggcacatg gccgatgcgc      2100
     accgagctgg gcaatcggat gcgcgggcag gaatccaatg cgcttgcgtc gagcattgtt      2160
     ctggtttgtc gtccgcgttc ggctacggcg gataccattt cccgccgtgt gttccaacgg      2220
     gagttgaacc aggttctgcc cgaggcgctg gacgagatga cacgcggctc cggagaagac      2280
     cgttcccccg tcgcgccggt tgatctctct caagccatta tcggccccgg catggcggtg      2340
     ttctcgaaat atgctgctgt cctggaggcg gacggcactc caatgactgt gcaaacggcg      2400
     ttgcggctta tcaatcgctt cctcgccgag gatgacttcg atcacgactc ccaattttgc      2460
     ttgcattggt tcgagcaata cggctggaag gaaggccggt tcggcgaggc ggatacgctc      2520
     gcacgcgcca aaggtacgag tgttgacggt gtgaagcagt cgggcgtgct gttagccatg      2580
     ggtggcattg tgcggctatt gaagtgggct gagtaccctg ccgaatggga cccaacgaac      2640
     gacgcacgct tgcccgtgtg ggaagccctg catcatctga tccgcgtgtt caagactgac      2700
     ggcgaaagcg gcgccggcaa agtgcttgcg gccatcgcgg ctaaggccga gccgacgcgt      2760
     cagcttgcct atcgcctcta cacgctttgc gagcgagcag gctgggcgga ggatgcccgt      2820
     gcttataacg aaatcataac aagctggggc gccatcgagt ccggcgccgc aatggcaccg      2880
     aaggcgcgtc aaagcgactt gtttggttaa                                       2910
//

If you have problems or comments...

PBIL Back to PBIL home page