(data stored in ACNUC7421 zone)

EMBL: CP001622.PE199

CP001622.PE199       Location/Qualifiers
FT   CDS_pept        complement(205492..206133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc04429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54511"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:C6B092"
FT                   /inference="similar to AA sequence:KEGG:SMc04429"
FT                   /protein_id="ACS54511.1"
FT                   /translation="MWRLDRIVYPAPPCLGGYHHSTHSWQDVISGHKAEIRMHLEAMQG
FT                   RRCAYCEGDIDSLGQHIEHFRRKSLHSALTFDWDNLFWSCDQTDSCGHFKDNGAGQYDV
FT                   ADLINPCFDDPDVFFVFQADGTISIRHGLSAVDEHRARETLRILSLDAEWGRLRVMRKI
FT                   AVSGYVDDADTAFNEGWPPDDICSYFAEELECARNLPFYTAIRHVLTERQ"
     atgtggagac ttgatcgcat tgtctacccc gcgccgcctt gcttgggtgg ctatcatcac        60
     agcacgcact cgtggcagga cgtaatctcc ggccacaagg cggaaattag aatgcatctg       120
     gaagcgatgc aaggtcggcg ctgcgcctat tgcgagggcg acatcgactc actcggccag       180
     cacatagagc atttccggcg gaaaagcctg cattccgcgt tgactttcga ttgggataac       240
     ctcttttggt cttgcgacca aacggactcc tgcggccact tcaaagataa cggcgcaggt       300
     caatacgacg tagccgacct gataaacccg tgcttcgacg accccgacgt tttctttgtc       360
     tttcaggcag acggcacgat cagcatcagg catggccttt cggcggtgga cgaacaccgc       420
     gctagggaga cgttacgcat cctttcgctt gatgccgagt gggggcgact gcgtgtcatg       480
     cgcaaaatcg ctgtgtcggg atacgttgac gacgctgaca ctgcattcaa cgaaggttgg       540
     ccacccgatg atatttgctc atactttgcg gaagagcttg agtgcgctcg caatctgcca       600
     ttttacacgg caatccggca tgtgttgact gaaagacaat aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page